Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-21R, Rat (HEK293, His)

IL-21R Protein, a receptor for interleukin-21, is a type I cytokine receptor. It forms a heterodimer with the common gamma subunit and associates with Janus kinase 1 (JAK1) . These interactions are pivotal for transducing the cellular responses initiated by interleukin-21, regulating immune processes and inflammatory pathways. IL-21R Protein, Rat (HEK293, His) is the recombinant rat-derived IL-21R protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

IL-21R Protein, Rat (HEK293, His), Rat, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-21r-protein-rat-hek293-his.html

Purity

97.80

Smiles

CLDLTCYTDYLWTITCVLETWSPNPSILSLTWQDEYEELQDKETSCSLHASGHNTTHMWYTCHMRLSQFMSDDVFTVNMMDQSSNSSQECGSFVLAESIKPAPPLNVTVTFSGRYDISWDSIYEEPSNYVLRGKLQYELQYRNLRDPYAVRPVTKLISVDSRNISLLPQEFQKDSSYQLQVRAAPQPGTSFRGTWSEWSDPIIFQTQAEEPEAGWDP

Molecular Formula

308977 (Gene_ID) Q5EBB1 (C20-P236) (Accession)

Molecular Weight

32-50 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

NUDT8 (Nucleoside Diphosphate-linked Moiety X Motif 8, Mitochondrial, Nudix Motif 8)
MBS644416-01 0.05 mg

NUDT8 (Nucleoside Diphosphate-linked Moiety X Motif 8, Mitochondrial, Nudix Motif 8)

Sign In for Pricing
View Details
NUDT8 (Nucleoside Diphosphate-linked Moiety X Motif 8, Mitochondrial, Nudix Motif 8)
MBS644416-02 5x 0.05 mg

NUDT8 (Nucleoside Diphosphate-linked Moiety X Motif 8, Mitochondrial, Nudix Motif 8)

Sign In for Pricing
View Details
Anti-Human CD226/DNAM-1 Antibody (SAA0074), APC
FHH18913 100 Tests

Anti-Human CD226/DNAM-1 Antibody (SAA0074), APC

Sign In for Pricing
View Details
Porcine Calmodulin-regulated spectrin-associated protein 3 (KIAA1543) ELISA Kit
MBS7233759-01 48 Well

Porcine Calmodulin-regulated spectrin-associated protein 3 (KIAA1543) ELISA Kit

Sign In for Pricing
View Details
Porcine Calmodulin-regulated spectrin-associated protein 3 (KIAA1543) ELISA Kit
MBS7233759-02 96 Well

Porcine Calmodulin-regulated spectrin-associated protein 3 (KIAA1543) ELISA Kit

Sign In for Pricing
View Details
Porcine Calmodulin-regulated spectrin-associated protein 3 (KIAA1543) ELISA Kit
MBS7233759-03 5x 96 Well

Porcine Calmodulin-regulated spectrin-associated protein 3 (KIAA1543) ELISA Kit

Sign In for Pricing
View Details