Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-21R, Rat (HEK293, His)

IL-21R Protein, a receptor for interleukin-21, is a type I cytokine receptor. It forms a heterodimer with the common gamma subunit and associates with Janus kinase 1 (JAK1) . These interactions are pivotal for transducing the cellular responses initiated by interleukin-21, regulating immune processes and inflammatory pathways. IL-21R Protein, Rat (HEK293, His) is the recombinant rat-derived IL-21R protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

IL-21R Protein, Rat (HEK293, His), Rat, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-21r-protein-rat-hek293-his.html

Purity

97.80

Smiles

CLDLTCYTDYLWTITCVLETWSPNPSILSLTWQDEYEELQDKETSCSLHASGHNTTHMWYTCHMRLSQFMSDDVFTVNMMDQSSNSSQECGSFVLAESIKPAPPLNVTVTFSGRYDISWDSIYEEPSNYVLRGKLQYELQYRNLRDPYAVRPVTKLISVDSRNISLLPQEFQKDSSYQLQVRAAPQPGTSFRGTWSEWSDPIIFQTQAEEPEAGWDP

Molecular Formula

308977 (Gene_ID) Q5EBB1 (C20-P236) (Accession)

Molecular Weight

32-50 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal VSV-G Epitope Tag Antibody [PerCP]
NB100-2485PCP 0.1 mL

Rabbit Polyclonal VSV-G Epitope Tag Antibody [PerCP]

Sign In for Pricing
View Details
DONSON Recombinant Protein (Human)
RP055449 100 µg

DONSON Recombinant Protein (Human)

Sign In for Pricing
View Details
Zika virus
bsm-72479M 100 µg

Zika virus

Sign In for Pricing
View Details
Reg2 AAV Vector (Mouse) (CMV)
38795104 1 µg

Reg2 AAV Vector (Mouse) (CMV)

Sign In for Pricing
View Details
TIGD7 (NM_033208) Human Tagged Lenti ORF Clone
RC210210L4 10 µg

TIGD7 (NM_033208) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
ZNF7, CT (ZNF7, KOX4, Zinc finger protein 7, Zinc finger protein HF.16, Zinc finger protein KOX4) (MaxLight 405)
MBS6367509-01 0.1 mL

ZNF7, CT (ZNF7, KOX4, Zinc finger protein 7, Zinc finger protein HF.16, Zinc finger protein KOX4) (MaxLight 405)

Sign In for Pricing
View Details