Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-21R, Rat (HEK293, His)

IL-21R Protein, a receptor for interleukin-21, is a type I cytokine receptor. It forms a heterodimer with the common gamma subunit and associates with Janus kinase 1 (JAK1) . These interactions are pivotal for transducing the cellular responses initiated by interleukin-21, regulating immune processes and inflammatory pathways. IL-21R Protein, Rat (HEK293, His) is the recombinant rat-derived IL-21R protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

IL-21R Protein, Rat (HEK293, His), Rat, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-21r-protein-rat-hek293-his.html

Purity

97.80

Smiles

CLDLTCYTDYLWTITCVLETWSPNPSILSLTWQDEYEELQDKETSCSLHASGHNTTHMWYTCHMRLSQFMSDDVFTVNMMDQSSNSSQECGSFVLAESIKPAPPLNVTVTFSGRYDISWDSIYEEPSNYVLRGKLQYELQYRNLRDPYAVRPVTKLISVDSRNISLLPQEFQKDSSYQLQVRAAPQPGTSFRGTWSEWSDPIIFQTQAEEPEAGWDP

Molecular Formula

308977 (Gene_ID) Q5EBB1 (C20-P236) (Accession)

Molecular Weight

32-50 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

CBX6 and CBX8 Antibody
abx432458 200 µL

CBX6 and CBX8 Antibody

Sign In for Pricing
View Details
Human CIZ1 Knockout A549 cell line
GTR15416170 1 Vial

Human CIZ1 Knockout A549 cell line

Sign In for Pricing
View Details
DCK (6S14) Mouse Monoclonal antibody
E28PE0472 100 µL

DCK (6S14) Mouse Monoclonal antibody

Sign In for Pricing
View Details
4-Bromopyridazine Hydrobromide
TRC-B686785-100MG 100 mg

4-Bromopyridazine Hydrobromide

Sign In for Pricing
View Details
C-Rel shRNA (h) Lentiviral Particles
sc-29857-V 200 µL

C-Rel shRNA (h) Lentiviral Particles

Sign In for Pricing
View Details
Sipa1l3 Mouse qPCR Primer Pair (NM_001081028)
MP215448 200 Reactions

Sipa1l3 Mouse qPCR Primer Pair (NM_001081028)

Sign In for Pricing
View Details