Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-21R, Rat (HEK293, His)

IL-21R Protein, a receptor for interleukin-21, is a type I cytokine receptor. It forms a heterodimer with the common gamma subunit and associates with Janus kinase 1 (JAK1) . These interactions are pivotal for transducing the cellular responses initiated by interleukin-21, regulating immune processes and inflammatory pathways. IL-21R Protein, Rat (HEK293, His) is the recombinant rat-derived IL-21R protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

IL-21R Protein, Rat (HEK293, His), Rat, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-21r-protein-rat-hek293-his.html

Purity

97.80

Smiles

CLDLTCYTDYLWTITCVLETWSPNPSILSLTWQDEYEELQDKETSCSLHASGHNTTHMWYTCHMRLSQFMSDDVFTVNMMDQSSNSSQECGSFVLAESIKPAPPLNVTVTFSGRYDISWDSIYEEPSNYVLRGKLQYELQYRNLRDPYAVRPVTKLISVDSRNISLLPQEFQKDSSYQLQVRAAPQPGTSFRGTWSEWSDPIIFQTQAEEPEAGWDP

Molecular Formula

308977 (Gene_ID) Q5EBB1 (C20-P236) (Accession)

Molecular Weight

32-50 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

1-(2,4-Dichlorobenzoyl)-2-(1-naphthoyl)hydrazine
TRC-D438898-250MG 250 mg

1-(2,4-Dichlorobenzoyl)-2-(1-naphthoyl)hydrazine

Sign In for Pricing
View Details
MCP-1 ELISA Kit| Rabbit Monocyte Chemotactic Protein 1 ELISA Kit
EF016833 96 Tests

MCP-1 ELISA Kit| Rabbit Monocyte Chemotactic Protein 1 ELISA Kit

Sign In for Pricing
View Details
Asap1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 2)
K4677607 1.0 µg DNA

Asap1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 2)

Sign In for Pricing
View Details
Protein-c Receptor Protein
abx261298-01 5 µg

Protein-c Receptor Protein

Sign In for Pricing
View Details
Protein-c Receptor Protein
abx261298-02 20 µg

Protein-c Receptor Protein

Sign In for Pricing
View Details
Protein-c Receptor Protein
abx261298-03 1 mg

Protein-c Receptor Protein

Sign In for Pricing
View Details