Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-21R, Rat (HEK293, His)

IL-21R Protein, a receptor for interleukin-21, is a type I cytokine receptor. It forms a heterodimer with the common gamma subunit and associates with Janus kinase 1 (JAK1) . These interactions are pivotal for transducing the cellular responses initiated by interleukin-21, regulating immune processes and inflammatory pathways. IL-21R Protein, Rat (HEK293, His) is the recombinant rat-derived IL-21R protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

IL-21R Protein, Rat (HEK293, His), Rat, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-21r-protein-rat-hek293-his.html

Purity

97.80

Smiles

CLDLTCYTDYLWTITCVLETWSPNPSILSLTWQDEYEELQDKETSCSLHASGHNTTHMWYTCHMRLSQFMSDDVFTVNMMDQSSNSSQECGSFVLAESIKPAPPLNVTVTFSGRYDISWDSIYEEPSNYVLRGKLQYELQYRNLRDPYAVRPVTKLISVDSRNISLLPQEFQKDSSYQLQVRAAPQPGTSFRGTWSEWSDPIIFQTQAEEPEAGWDP

Molecular Formula

308977 (Gene_ID) Q5EBB1 (C20-P236) (Accession)

Molecular Weight

32-50 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

LEMD1 cDNA Clone
MBS1274417-01 0.01 mg Plasmid + 0.2 mL Glycerol-Stock

LEMD1 cDNA Clone

Sign In for Pricing
View Details
LEMD1 cDNA Clone
MBS1274417-02 5x 0.01 mg Plasmid + 5x 0.2 mL Glycerol-Stock

LEMD1 cDNA Clone

Sign In for Pricing
View Details
Phospho-TP53 (S15) Antibody
A11053-50UG 50 µg

Phospho-TP53 (S15) Antibody

Sign In for Pricing
View Details
Ly6c1 ORF Vector (Mouse) (pORF)
ORF049554 1.0 µg DNA

Ly6c1 ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details
ADAMTS10 Polyclonal Antibody, AbBy Fluor™ 594 Conjugated
bs-6588R-BF594 100 µL

ADAMTS10 Polyclonal Antibody, AbBy Fluor™ 594 Conjugated

Sign In for Pricing
View Details
Rabbit Polyclonal GMEB2 Antibody [Allophycocyanin]
NBP2-12763APC 0.1 mL

Rabbit Polyclonal GMEB2 Antibody [Allophycocyanin]

Sign In for Pricing
View Details