Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-21R, Rat (HEK293, His)

IL-21R Protein, a receptor for interleukin-21, is a type I cytokine receptor. It forms a heterodimer with the common gamma subunit and associates with Janus kinase 1 (JAK1) . These interactions are pivotal for transducing the cellular responses initiated by interleukin-21, regulating immune processes and inflammatory pathways. IL-21R Protein, Rat (HEK293, His) is the recombinant rat-derived IL-21R protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

IL-21R Protein, Rat (HEK293, His), Rat, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-21r-protein-rat-hek293-his.html

Purity

97.80

Smiles

CLDLTCYTDYLWTITCVLETWSPNPSILSLTWQDEYEELQDKETSCSLHASGHNTTHMWYTCHMRLSQFMSDDVFTVNMMDQSSNSSQECGSFVLAESIKPAPPLNVTVTFSGRYDISWDSIYEEPSNYVLRGKLQYELQYRNLRDPYAVRPVTKLISVDSRNISLLPQEFQKDSSYQLQVRAAPQPGTSFRGTWSEWSDPIIFQTQAEEPEAGWDP

Molecular Formula

308977 (Gene_ID) Q5EBB1 (C20-P236) (Accession)

Molecular Weight

32-50 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant TTF-1 Antibody / NKX2.1
V3654-20UG 20 µg

Recombinant TTF-1 Antibody / NKX2.1

Sign In for Pricing
View Details
MRII, CT (Anti-Muellerian Hormone Type II Receptor, Anti-Muellerian Hormone Type II Receptor, AMH Type II Receptor, MIS Type II Receptor, MISRII, AMHR2, AMHR) (MaxLight 750) discontinued
M3955-30D-ML750 100 µL

MRII, CT (Anti-Muellerian Hormone Type II Receptor, Anti-Muellerian Hormone Type II Receptor, AMH Type II Receptor, MIS Type II Receptor, MISRII, AMHR2, AMHR) (MaxLight 750) discontinued

Sign In for Pricing
View Details
Tarafenacin D-tartrate 2mg
A21477-2 2 mg

Tarafenacin D-tartrate 2mg

Sign In for Pricing
View Details
Rat Cadherin 8 (CDH8) ELISA Kit
abx504621 96 Tests

Rat Cadherin 8 (CDH8) ELISA Kit

Sign In for Pricing
View Details
Vmn1r53 siRNA Oligos set (Mouse)
49680174 3x 5 nmol

Vmn1r53 siRNA Oligos set (Mouse)

Sign In for Pricing
View Details
Human NFIL3 (NM_005384) AAV Particle
RC201537A1V 250 µL

Human NFIL3 (NM_005384) AAV Particle

Sign In for Pricing
View Details