Animal-Free MIG/CXCL9, Pig (His)
The CXCL9 protein is part of the intercrine alpha family of chemokines critical for cell-to-cell communication and immune responses. In this family, CXCL9 may play a key role in regulating inflammatory processes and influencing cellular interactions. Animal-Free MIG/CXCL9 Protein, Pig (His) is the recombinant pig-derived animal-Free CXCL9 protein, expressed by E. coli , with N-His labeled tag.This product is for cell culture use only.
Product Specifications
Product Name Alternative
Animal-Free MIG/CXCL9 Protein, Pig (His), Pig, E. coli
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/animal-free-cxcl9-protein-pig-his.html
Smiles
TLLMRNGRCSCINTSQRMIHLKSLRDLKQFAPSPSCEKMEVIATMKNGDQTCLNPDSPDVKKLIKEWEKQVSLKKKQKKGKKHPKTKKVRKVKKSQRPDQKKMT
Molecular Formula
100135681 (Gene_ID) B0FYK2 (T23-T126) (Accession)
Molecular Weight
Approximately 11 kDa, based on SDS-PAGE under reducing conditions.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Scientific Category
Recombinant Proteins
Frequently Asked Questions
Explore Other Products
Browse additional items from our catalog