Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MIA, Human (His)

MIA proteins exhibit significant growth inhibitory effects on melanoma cells in vitro, extending their effects to various neuroectodermal tumors such as gliomas. In addition to playing an inhibitory role in cell growth, MIA proteins are also involved in molecular interactions, interacting with FASLG and TMIGD2. MIA Protein, Human (His) is the recombinant human-derived MIA protein, expressed by E. coli , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

MIA Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/mia-protein-human-his.html

Purity

95.0

Smiles

GPMPKLADRKLCADQECSHPISMAVALQDYMAPDCRFLTIHRGQVVYVFSKLKGRGRLFWGGSVQGDYYGDLAARLGYFPSSIVREDQTLKPGKVDVKTDKWDFYCQ

Molecular Formula

8190 (Gene_ID) Q16674 (G25-Q131) (Accession)

Molecular Weight

Approximately 14 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Zfp51 Protein Vector (Rat) (pPB-C-His)
PV317898 500 ng

Zfp51 Protein Vector (Rat) (pPB-C-His)

Sign In for Pricing
View Details
Mouse Gm1527 qPCR Primer Pair
QM73458S 200 Tests

Mouse Gm1527 qPCR Primer Pair

Sign In for Pricing
View Details
Rabbit Polyclonal TFII-I Antibody [DyLight 650]
NB500-157C 0.1 mL

Rabbit Polyclonal TFII-I Antibody [DyLight 650]

Sign In for Pricing
View Details
Rat Wwc1 Pre-designed siRNA Set A
SI216035A 1 Each

Rat Wwc1 Pre-designed siRNA Set A

Sign In for Pricing
View Details
PINCH (3C12) Mouse mAb Antibody
orb3013948 100 µL

PINCH (3C12) Mouse mAb Antibody

Sign In for Pricing
View Details
SLAMF6 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)
43855061 1.0 µg DNA

SLAMF6 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details