Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-17RB, Human (HEK293, His)

IL-17RB (Interleukin 17 receptor B), a protein encoded by the IL17RB gene, is a receptor for the pro-inflammatory cytokines IL17B and IL17E. IL-17RB expression is high in kidney, pancreas, liver, brain, and intestines. IL-17RB may play a role in hematopoietic cell differentiation and growth. IL-17RB is involved in inflammatory diseases and cancers[1][2]. IL-17RB Protein, Human (HEK293, His) is produced in HEK293 cells with six C-Terminal His-tags.

Product Specifications

Product Name Alternative

IL-17RB Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-17rb-protein-human-272a-a-hek293-his.html

Smiles

REPTVQCGSETGPSPEWMLQHDLIPGDLRDLRVEPVTTSVATGDYSILMNVSWVLRADASIRLLKATKICVTGKSNFQSYSCVRCNYTEAFQTQTRPSGGKWTFSYIGFPVELNTVYFIGAHNIPNANMNEDGPSMSVNFTSPGCLDHIMKYKKKCVKAGSLWDPNITACKKNEETVEVNFTTTPLGNRYMALIQHSTIIGFSQVFEPHQKKQTRASVVIPVTGDSEGATVQLTPYFPTCGSDCIRHKGTVVLCPQTGVPFPLDNNKSKPGG

Molecular Formula

55540 (Gene_ID) Q9NRM6-1 (R18-G289) (Accession)

Molecular Weight

Approximately 38-50 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

References & Citations

[1]Lei Ren, et al. IL-17RB enhances thyroid cancer cell invasion and metastasis via ERK1/2 pathway-mediated MMP-9 expression. Mol Immunol. 2017 Oct;90:126-135.|[2]Y Shi, et al. A novel cytokine receptor-ligand pair. Identification, molecular characterization, and in vivo immunomodulatory activity. J Biol Chem. 2000 Jun 23;275 (25) :19167-76.|[3]Jérémy Bastid, et al. The Emerging Role of the IL-17B/IL-17RB Pathway in Cancer. Front Immunol. 2020 Apr 21;11:718.|[4]Erika A Rickel, et al. Identification of functional roles for both IL-17RB and IL-17RA in mediating IL-25-induced activities. J Immunol. 2008 Sep 15;181 (6) :4299-310.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Loxosceles deserta Sphingomyelin phosphodiesterase D LdSicTox-alphaIB3ai
MBS1214849-01 0.02 mg (E-Coli)

Recombinant Loxosceles deserta Sphingomyelin phosphodiesterase D LdSicTox-alphaIB3ai

Sign In for Pricing
View Details
Recombinant Loxosceles deserta Sphingomyelin phosphodiesterase D LdSicTox-alphaIB3ai
MBS1214849-02 0.02 mg (Yeast)

Recombinant Loxosceles deserta Sphingomyelin phosphodiesterase D LdSicTox-alphaIB3ai

Sign In for Pricing
View Details
Recombinant Loxosceles deserta Sphingomyelin phosphodiesterase D LdSicTox-alphaIB3ai
MBS1214849-03 0.1 mg (E-Coli)

Recombinant Loxosceles deserta Sphingomyelin phosphodiesterase D LdSicTox-alphaIB3ai

Sign In for Pricing
View Details
Recombinant Loxosceles deserta Sphingomyelin phosphodiesterase D LdSicTox-alphaIB3ai
MBS1214849-04 0.1 mg (Yeast)

Recombinant Loxosceles deserta Sphingomyelin phosphodiesterase D LdSicTox-alphaIB3ai

Sign In for Pricing
View Details
Recombinant Loxosceles deserta Sphingomyelin phosphodiesterase D LdSicTox-alphaIB3ai
MBS1214849-05 0.02 mg (Baculovirus)

Recombinant Loxosceles deserta Sphingomyelin phosphodiesterase D LdSicTox-alphaIB3ai

Sign In for Pricing
View Details
Recombinant Loxosceles deserta Sphingomyelin phosphodiesterase D LdSicTox-alphaIB3ai
MBS1214849-06 0.02 mg (Mammalian-Cell)

Recombinant Loxosceles deserta Sphingomyelin phosphodiesterase D LdSicTox-alphaIB3ai

Sign In for Pricing
View Details