Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BTLA/CD272, Human (HEK293, His)

The BTLA/CD272 protein is expressed on lymphocytes and is a negative regulator of antigen receptor signaling. It interacts with the tyrosine phosphatases PTPN6/SHP-1 and PTPN11/SHP-2 to regulate immune responses and maintain lymphocyte homeostasis. BTLA/CD272 Protein, Human (HEK293, His) is the recombinant human-derived BTLA/CD272 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

BTLA/CD272 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/btla-cd272-protein-human-hek-293-his.html

Purity

95.0

Smiles

KESCDVQLYIKRQSEHSILAGDPFELECPVKYCANRPHVTWCKLNGTTCVKLEDRQTSWKEEKNISFFILHFEPVLPNDNGSYRCSANFQSNLIESHSTTLYVTGKQNELSDTAGREINLHHHHHH

Molecular Formula

151888 (Gene_ID) Q7Z6A9-2 (K31-L150) (Accession)

Molecular Weight

Approximately 30.0 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

PI 3 Kinase Class 3 Rabbit Polyclonal Antibody
E28PT5759 100 µL

PI 3 Kinase Class 3 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
RBM46 (Probable RNA-Binding Protein 46, RNA Binding Motif Protein 46)
490234 100 µL

RBM46 (Probable RNA-Binding Protein 46, RNA Binding Motif Protein 46)

Sign In for Pricing
View Details
Recombinant human LRRC4 Protein, His Tag
KMP1326 50 µg

Recombinant human LRRC4 Protein, His Tag

Sign In for Pricing
View Details
TGIF2P3 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)
K2365907 1.0 µg DNA

TGIF2P3 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
CD8 (Leu2 T lymphocyte antigen, MAL, OKT8 T Cell antigen, p32, T cell antigen Leu2, T cell surface glycoprotein CD8 alpha, Suppressor/Cytotoxic T cell) (PE) discontinued
C2258-91B-PE 100 µL

CD8 (Leu2 T lymphocyte antigen, MAL, OKT8 T Cell antigen, p32, T cell antigen Leu2, T cell surface glycoprotein CD8 alpha, Suppressor/Cytotoxic T cell) (PE) discontinued

Sign In for Pricing
View Details
Macrophage Inflammatory Protein 3 alpha (MIP-3-alpha, MIP3A, MIP-3a, Beta Chemokine Exodus-1, CC Chemokine LARC, C-C Motif Chemokine 20, Chemokine (C-C Motif) Ligand 20, CCL20, CKb4, Liver and Activation-regulated Chemokine, LARC, Small-inducible Cytokine A20, SCYA20, ST38) (HRP)
M1202-60K-HRP 100 µL

Macrophage Inflammatory Protein 3 alpha (MIP-3-alpha, MIP3A, MIP-3a, Beta Chemokine Exodus-1, CC Chemokine LARC, C-C Motif Chemokine 20, Chemokine (C-C Motif) Ligand 20, CCL20, CKb4, Liver and Activation-regulated Chemokine, LARC, Small-inducible Cytokine A20, SCYA20, ST38) (HRP)

Sign In for Pricing
View Details