Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BTLA/CD272, Human (HEK293, His)

The BTLA/CD272 protein is expressed on lymphocytes and is a negative regulator of antigen receptor signaling. It interacts with the tyrosine phosphatases PTPN6/SHP-1 and PTPN11/SHP-2 to regulate immune responses and maintain lymphocyte homeostasis. BTLA/CD272 Protein, Human (HEK293, His) is the recombinant human-derived BTLA/CD272 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

BTLA/CD272 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/btla-cd272-protein-human-hek-293-his.html

Purity

95.0

Smiles

KESCDVQLYIKRQSEHSILAGDPFELECPVKYCANRPHVTWCKLNGTTCVKLEDRQTSWKEEKNISFFILHFEPVLPNDNGSYRCSANFQSNLIESHSTTLYVTGKQNELSDTAGREINLHHHHHH

Molecular Formula

151888 (Gene_ID) Q7Z6A9-2 (K31-L150) (Accession)

Molecular Weight

Approximately 30.0 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD117/c-kit, Human (P10721-2, HEK293, Fc)
HY-P74339 1 Each

CD117/c-kit, Human (P10721-2, HEK293, Fc)

Sign In for Pricing
View Details
Bacillus anthracis (Anthrax) (PE) discontinued
226843-PE 100 µL

Bacillus anthracis (Anthrax) (PE) discontinued

Sign In for Pricing
View Details
Porcine Epoxide hydrolase 1 (EPHX1) ELISA Kit
MBS7240576-01 48 Well

Porcine Epoxide hydrolase 1 (EPHX1) ELISA Kit

Sign In for Pricing
View Details
Porcine Epoxide hydrolase 1 (EPHX1) ELISA Kit
MBS7240576-02 96 Well

Porcine Epoxide hydrolase 1 (EPHX1) ELISA Kit

Sign In for Pricing
View Details
Porcine Epoxide hydrolase 1 (EPHX1) ELISA Kit
MBS7240576-03 5x 96 Well

Porcine Epoxide hydrolase 1 (EPHX1) ELISA Kit

Sign In for Pricing
View Details
Porcine Epoxide hydrolase 1 (EPHX1) ELISA Kit
MBS7240576-04 10x 96 Well

Porcine Epoxide hydrolase 1 (EPHX1) ELISA Kit

Sign In for Pricing
View Details