Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BTLA/CD272, Human (HEK293, His)

The BTLA/CD272 protein is expressed on lymphocytes and is a negative regulator of antigen receptor signaling. It interacts with the tyrosine phosphatases PTPN6/SHP-1 and PTPN11/SHP-2 to regulate immune responses and maintain lymphocyte homeostasis. BTLA/CD272 Protein, Human (HEK293, His) is the recombinant human-derived BTLA/CD272 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

BTLA/CD272 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/btla-cd272-protein-human-hek-293-his.html

Purity

95.0

Smiles

KESCDVQLYIKRQSEHSILAGDPFELECPVKYCANRPHVTWCKLNGTTCVKLEDRQTSWKEEKNISFFILHFEPVLPNDNGSYRCSANFQSNLIESHSTTLYVTGKQNELSDTAGREINLHHHHHH

Molecular Formula

151888 (Gene_ID) Q7Z6A9-2 (K31-L150) (Accession)

Molecular Weight

Approximately 30.0 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse insulin-degrading enzyme, IDE ELISA Kit
CK-bio-16416-01 48 Tests

Mouse insulin-degrading enzyme, IDE ELISA Kit

Sign In for Pricing
View Details
Mouse insulin-degrading enzyme, IDE ELISA Kit
CK-bio-16416-02 96 Tests

Mouse insulin-degrading enzyme, IDE ELISA Kit

Sign In for Pricing
View Details
Mouse insulin-degrading enzyme, IDE ELISA Kit
CK-bio-16416-03 5x 96 Tests

Mouse insulin-degrading enzyme, IDE ELISA Kit

Sign In for Pricing
View Details
Mouse insulin-degrading enzyme, IDE ELISA Kit
CK-bio-16416-04 10x 96 Tests

Mouse insulin-degrading enzyme, IDE ELISA Kit

Sign In for Pricing
View Details
TCEA2 Protein Lysate (Human) with C-Ha Tag
46324032 100 µg

TCEA2 Protein Lysate (Human) with C-Ha Tag

Sign In for Pricing
View Details
Toll Like Receptor 3 (TLR3) Antibody (FITC)
abx273661-01 200 µL

Toll Like Receptor 3 (TLR3) Antibody (FITC)

Sign In for Pricing
View Details