BTLA/CD272, Human (HEK293, His)
The BTLA/CD272 protein is expressed on lymphocytes and is a negative regulator of antigen receptor signaling. It interacts with the tyrosine phosphatases PTPN6/SHP-1 and PTPN11/SHP-2 to regulate immune responses and maintain lymphocyte homeostasis. BTLA/CD272 Protein, Human (HEK293, His) is the recombinant human-derived BTLA/CD272 protein, expressed by HEK293 , with C-6*His labeled tag.
Product Specifications
Product Name Alternative
BTLA/CD272 Protein, Human (HEK293, His), Human, HEK293
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/btla-cd272-protein-human-hek-293-his.html
Purity
95.0
Smiles
KESCDVQLYIKRQSEHSILAGDPFELECPVKYCANRPHVTWCKLNGTTCVKLEDRQTSWKEEKNISFFILHFEPVLPNDNGSYRCSANFQSNLIESHSTTLYVTGKQNELSDTAGREINLHHHHHH
Molecular Formula
151888 (Gene_ID) Q7Z6A9-2 (K31-L150) (Accession)
Molecular Weight
Approximately 30.0 kDa
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Explore Other Products
Browse additional items from our catalog
Aurka, NT (Aurka, Aik, Airk, Ark1, Aura, Ayk1, Btak, Iak1, Stk15, Stk6, Aurora kinase A, Aurora 2, Aurora family kinase 1, Aurora/IPL1-related kinase 1, Ipl1-and aurora-related kinase 1, Serine/threonine-protein kinase 6, Serine/threonine-protein kinase A
Aurka, NT (Aurka, Aik, Airk, Ark1, Aura, Ayk1, Btak, Iak1, Stk15, Stk6, Aurora kinase A, Aurora 2, Aurora family kinase 1, Aurora/IPL1-related kinase 1, Ipl1-and aurora-related kinase 1, Serine/threonine-protein kinase 6, Serine/threonine-protein kinase A
