Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BTLA/CD272, Human (HEK293, His)

The BTLA/CD272 protein is expressed on lymphocytes and is a negative regulator of antigen receptor signaling. It interacts with the tyrosine phosphatases PTPN6/SHP-1 and PTPN11/SHP-2 to regulate immune responses and maintain lymphocyte homeostasis. BTLA/CD272 Protein, Human (HEK293, His) is the recombinant human-derived BTLA/CD272 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

BTLA/CD272 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/btla-cd272-protein-human-hek-293-his.html

Purity

95.0

Smiles

KESCDVQLYIKRQSEHSILAGDPFELECPVKYCANRPHVTWCKLNGTTCVKLEDRQTSWKEEKNISFFILHFEPVLPNDNGSYRCSANFQSNLIESHSTTLYVTGKQNELSDTAGREINLHHHHHH

Molecular Formula

151888 (Gene_ID) Q7Z6A9-2 (K31-L150) (Accession)

Molecular Weight

Approximately 30.0 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

PSMB8 (Biotin)
573646-01 50 µL

PSMB8 (Biotin)

Sign In for Pricing
View Details
PSMB8 (Biotin)
573646-02 100 µL

PSMB8 (Biotin)

Sign In for Pricing
View Details
RNF6 ORF Vector (Human) (pORF)
40318011 1.0 µg DNA

RNF6 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
Mouse Urotensin-2B (UTS2D) ELISA Kit
MBS283944-01 48 Tests

Mouse Urotensin-2B (UTS2D) ELISA Kit

Sign In for Pricing
View Details
Mouse Urotensin-2B (UTS2D) ELISA Kit
MBS283944-02 96 Tests

Mouse Urotensin-2B (UTS2D) ELISA Kit

Sign In for Pricing
View Details
Mouse Urotensin-2B (UTS2D) ELISA Kit
MBS283944-03 5x 96 Tests

Mouse Urotensin-2B (UTS2D) ELISA Kit

Sign In for Pricing
View Details