Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BTLA/CD272, Human (HEK293, His)

The BTLA/CD272 protein is expressed on lymphocytes and is a negative regulator of antigen receptor signaling. It interacts with the tyrosine phosphatases PTPN6/SHP-1 and PTPN11/SHP-2 to regulate immune responses and maintain lymphocyte homeostasis. BTLA/CD272 Protein, Human (HEK293, His) is the recombinant human-derived BTLA/CD272 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

BTLA/CD272 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/btla-cd272-protein-human-hek-293-his.html

Purity

95.0

Smiles

KESCDVQLYIKRQSEHSILAGDPFELECPVKYCANRPHVTWCKLNGTTCVKLEDRQTSWKEEKNISFFILHFEPVLPNDNGSYRCSANFQSNLIESHSTTLYVTGKQNELSDTAGREINLHHHHHH

Molecular Formula

151888 (Gene_ID) Q7Z6A9-2 (K31-L150) (Accession)

Molecular Weight

Approximately 30.0 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Trim50 3'UTR Luciferase Stable Cell Line
TU121116 1.0 mL

Trim50 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Lentiviral human PLA2G12A shRNA (UAS) - Lentiviral human PLA2G12A shRNA (UAS, iRFP) plasmid
GTR15164080 1 Vial

Lentiviral human PLA2G12A shRNA (UAS) - Lentiviral human PLA2G12A shRNA (UAS, iRFP) plasmid

Sign In for Pricing
View Details
IARS (Isoleucyl-tRNA Synthetase, FLJ20736, IARS1, ILRS, PRO0785) (MaxLight 750)
MBS6451133-01 0.1 mL

IARS (Isoleucyl-tRNA Synthetase, FLJ20736, IARS1, ILRS, PRO0785) (MaxLight 750)

Sign In for Pricing
View Details
IARS (Isoleucyl-tRNA Synthetase, FLJ20736, IARS1, ILRS, PRO0785) (MaxLight 750)
MBS6451133-02 5x 0.1 mL

IARS (Isoleucyl-tRNA Synthetase, FLJ20736, IARS1, ILRS, PRO0785) (MaxLight 750)

Sign In for Pricing
View Details
HTF9C (TRMT2A) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI3B7]
TA505523AM 100 µL

HTF9C (TRMT2A) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI3B7]

Sign In for Pricing
View Details
Albumin Bovine Fraction V 98% (For Molecular Biology)
00092 00010 10 g

Albumin Bovine Fraction V 98% (For Molecular Biology)

Sign In for Pricing
View Details