PVR/CD155, Human (HEK293, Fc)
PVR/CD155 Protein, Human (HEK293, Fc), a Type I transmembrane glycoprotein in the immunoglobulin superfamily, is involved in the cellular poliovirus infection in primates and intestinal humoral immune responses.
Product Specifications
Product Name Alternative
PVR/CD155 Protein, Human (HEK293, Fc), Human, HEK293
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/pvr-cd155-protein-human-hek293-fc.html
Purity
97.0
Smiles
WPPPGTGDVVVQAPTQVPGFLGDSVTLPCYLQVPNMEVTHVSQLTWARHGESGSMAVFHQTQGPSYSESKRLEFVAARLGAELRNASLRMFGLRVEDEGNYTCLFVTFPQGSRSVDIWLRVLAKPQNTAEVQKVQLTGEPVPMARCVSTGGRPPAQITWHSDLGGMPNTSQVPGFLSGTVTVTSLWILVPSSQVDGKNVTCKVEHESFEKPQLLTVNLTVYYPPEVSISGYDNNWYLGQNEATLTCDARSNPEPTGYNWSTTMGPLPPFAVAQGAQLLIRPVDKPINTTLICNVTNALGARQAELTVQVKEGPPSEHSGISRN
Molecular Formula
5817 (Gene_ID) P15151-1 (W21-N343) (Accession)
Molecular Weight
80-105 kDa
References & Citations
[1]Mendelsohn CL, et al. Cellular receptor for poliovirus: molecular cloning, nucleotide sequence, and expression of a new member of the immunoglobulin superfamily. Cell. 1989 Mar 10;56 (5) :855-65.|[2]Maier MK, et al. The adhesion receptor CD155 determines the magnitude of humoral immune responses against orally ingested antigens. Eur J Immunol. 2007 Aug;37 (8) :2214-25.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC680225-500 1x 500 µL
Major Vault Protein (MVP) (1032), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC400003-500 1x 500 µL
CD45RO (UCHL-1), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC400977-100 1x 100 µL
TGF-beta (1D11.16.8), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC880204-100 1x 100 µL
Complement C4d (C4D204), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details