Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

4-1BB/TNFRSF9, Mouse (HEK293, His)

4-1BB (CD137; TNFRSF9), a receptor of TNFSF9/4-1BBL, belongs to the tumor necrosis factor (TNF) receptor superfamily[1]. 4-1BB is helpful for T cell activation and development, and also induces peripheral mononuclear cell proliferation and migration to the tumor microenvironment[2]. 4-1BB is also involved in enhancing Nrf2 and NF-κB pathway mediated apoptosis of endothelial cells[3]. Mouse 4-1BB protein is a surface glycoprotein with a transmembrane domain. 4-1BB/TNFRSF9 Protein, Mouse (HEK293, His) is the extracellular part (V24-L187) of 4-1BB protein, produced by HEK293 cells with C-terminal His-tag.

Product Specifications

Product Name Alternative

4-1BB/TNFRSF9 Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/4-1bb-tnfrsf9-protein-mouse-hek293-his.html

Purity

96.00

Smiles

MGNNCYNVVVIVLLLVGCEKVGAVQNSCDNCQPGTFCRKYNPVCKSCPPSTFSSIGGQPNCNICRVCAGYFRFKKFCSSTHNAECECIEGFHCLGPQCTRCEKDCRPGQELTKQGCKTCSLGTFNDQNGTGVCRPWTNCSLDGRSVLKTGTTEKDVVCGPPVVSFSPSTTISVTPEGGPGGHSLQVL

Molecular Formula

21942 (Gene_ID) P20334/NP_001070977 (V24-L187) (Accession)

Molecular Weight

Approximately 19.00 kDa

References & Citations

[1]Ye L, et al. CD137, an attractive candidate for the immunotherapy of lung cancer. Cancer Sci. 2020 May;111 (5) :1461-1467.|[2]Jiang P, et al. CD137 promotes bone metastasis of breast cancer by enhancing the migration and osteoclast differentiation of monocytes/macrophages. Theranostics. 2019 May 9;9 (10) :2950-2966.|[3]Geng T, et al. CD137 Signaling Promotes Endothelial Apoptosis by Inhibiting Nrf2 Pathway, and Upregulating NF-κB Pathway. Mediators Inflamm. 2020 Jun 6;2020:4321912.|[4]Pauly S, et al. CD137 is expressed by follicular dendritic cells and costimulates B lymphocyte activation in germinal centers. J Leukoc Biol. 2002 Jul;72 (1) :35-42.

Shipping Conditions

Dry ice

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cytokeratin 17 (E3), CF740 conjugate, 0.1mg/mL
BNC740158-500 1x 500 µL

Cytokeratin 17 (E3), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Calnexin (Endoplasmic Reticulum Marker) (CANX/1543), CF740 conjugate, 0.1mg/mL
BNC741543-100 1x 100 µL

Calnexin (Endoplasmic Reticulum Marker) (CANX/1543), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD30 / TNFRSF8 (Hodgkin & Reed-Sternberg Cell Marker) (rKi-1/779), CF405S conjugate, 0.1mg/mL
BNC041828-100 1x 100 µL

CD30 / TNFRSF8 (Hodgkin & Reed-Sternberg Cell Marker) (rKi-1/779), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
DOG-1 / TMEM16A (Gastrointestinal Stromal Tumor Marker) (DG1/1485), CF640R conjugate, 0.1mg/mL
BNC401485-500 1x 500 µL

DOG-1 / TMEM16A (Gastrointestinal Stromal Tumor Marker) (DG1/1485), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD4 (C4/206), CF647 conjugate, 0.1mg/mL
BNC470206-500 1x 500 µL

CD4 (C4/206), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
UACA / Nucling (AE-5), CF594 conjugate, 0.1mg/mL
BNC940956-100 1x 100 µL

UACA / Nucling (AE-5), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details