Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RecR, E.coli (His-SUMO)

RecR protein potentially plays a vital role in DNA repair, especially in RecBC-independent recombinational processes. It collaborates with RecF and RecO, suggesting its involvement in cooperative interactions within the cellular machinery dedicated to DNA repair. Further investigation is needed to elucidate RecR's precise functions and molecular interactions in maintaining genomic integrity through DNA repair. RecR Protein, E.coli (His-SUMO) is the recombinant E. coli-derived RecR protein, expressed by E. coli , with N-SUMO, N-6*His labeled tag.

Product Specifications

Product Name Alternative

RecR Protein, E.coli (His-SUMO), E.coli, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/recr-protein-e-coli-his-sumo.html

Purity

96.00

Smiles

MQTSPLLTQLMEALRCLPGVGPKSAQRMAFTLLQRDRSGGMRLAQALTRAMSEIGHCADCRTFTEQEVCNICSNPRRQENGQICVVESPADIYAIEQTGQFSGRYFVLMGHLSPLDGIGPDDIGLDRLEQRLAEEKITEVILATNPTVEGEATANYIAELCAQYDVEASRIAHGVPVGGELEMVDGTTLSHSLAGRHKIRF

Molecular Formula

66671226 (Gene_ID) P0A7H6 (M1-F201) (Accession)

Molecular Weight

Approximately 38.0 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ku70 (XRCC6) Rabbit Polyclonal Antibody
TA362773 100 µL

Ku70 (XRCC6) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
alpha-DTPEBBTD-C1
TRC-D710003-100MG 100 mg

alpha-DTPEBBTD-C1

Sign In for Pricing
View Details
PKIB (NM_181795) Human Recombinant Protein
TP312372M 100 µg

PKIB (NM_181795) Human Recombinant Protein

Sign In for Pricing
View Details
Aurora A (AURKA) (C-term) (incl. pos. control) Mouse Monoclonal Antibody [Clone ID: 5F11]
AM20208PU-N 100 µg

Aurora A (AURKA) (C-term) (incl. pos. control) Mouse Monoclonal Antibody [Clone ID: 5F11]

Sign In for Pricing
View Details
PerCP/Cyanine5.5 Anti-Human CD3 Antibody[OKT-3]
E-AB-F1001J-01 20 Tests

PerCP/Cyanine5.5 Anti-Human CD3 Antibody[OKT-3]

Sign In for Pricing
View Details
PerCP/Cyanine5.5 Anti-Human CD3 Antibody[OKT-3]
E-AB-F1001J-02 100 Tests

PerCP/Cyanine5.5 Anti-Human CD3 Antibody[OKT-3]

Sign In for Pricing
View Details