Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RecR, E.coli (His-SUMO)

RecR protein potentially plays a vital role in DNA repair, especially in RecBC-independent recombinational processes. It collaborates with RecF and RecO, suggesting its involvement in cooperative interactions within the cellular machinery dedicated to DNA repair. Further investigation is needed to elucidate RecR's precise functions and molecular interactions in maintaining genomic integrity through DNA repair. RecR Protein, E.coli (His-SUMO) is the recombinant E. coli-derived RecR protein, expressed by E. coli , with N-SUMO, N-6*His labeled tag.

Product Specifications

Product Name Alternative

RecR Protein, E.coli (His-SUMO), E.coli, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/recr-protein-e-coli-his-sumo.html

Purity

96.00

Smiles

MQTSPLLTQLMEALRCLPGVGPKSAQRMAFTLLQRDRSGGMRLAQALTRAMSEIGHCADCRTFTEQEVCNICSNPRRQENGQICVVESPADIYAIEQTGQFSGRYFVLMGHLSPLDGIGPDDIGLDRLEQRLAEEKITEVILATNPTVEGEATANYIAELCAQYDVEASRIAHGVPVGGELEMVDGTTLSHSLAGRHKIRF

Molecular Formula

66671226 (Gene_ID) P0A7H6 (M1-F201) (Accession)

Molecular Weight

Approximately 38.0 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Semaphorin 3D (SEMA3D) Human Gene Knockout Kit (CRISPR)
KN416032 1 Kit

Semaphorin 3D (SEMA3D) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
PKM2 (PKM) Mouse Monoclonal Antibody [Clone ID: AT1B10]
AM50349PU-N 100 µL

PKM2 (PKM) Mouse Monoclonal Antibody [Clone ID: AT1B10]

Sign In for Pricing
View Details
Plasma Kallikrein 1B (KLKB1) Rabbit Monoclonal Antibody
TA423179 100 µL

Plasma Kallikrein 1B (KLKB1) Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
CD14 (Monocyte / Macrophage Marker) (LPSR/2408), CF488A conjugate, 0.1mg/mL
BNC882408-500 1x 500 µL

CD14 (Monocyte / Macrophage Marker) (LPSR/2408), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
NAT1 Human Gene Knockout Kit (CRISPR)
KN221042BN 1 Kit

NAT1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Elab Fluor® 647 Anti-Human CD138/Syndecan-1 Antibody[B-B4]
E-AB-F1411M-01 20 Tests

Elab Fluor® 647 Anti-Human CD138/Syndecan-1 Antibody[B-B4]

Sign In for Pricing
View Details