Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Fc gamma RIIIA/CD16a, Human (HEK293, His)

Fc gamma RIIIA/CD16a protein is a receptor for the Fc fragment of IgG and activates antibody-dependent cellular cytotoxicity (ADCC) upon binding to antigen-IgG complexes. It mediates IgG effector functions on NK cells, generating memory-like adaptive NK cells to efficiently eliminate virally infected cells. Fc gamma RIIIA/CD16a Protein, Human (HEK293, His) is the recombinant human-derived Fc gamma RIIIA/CD16a protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

Fc gamma RIIIA/CD16a Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/fc-gamma-riiia-cd16a-protein-human-hek-293-his.html

Purity

99.00

Smiles

GMRTEDLPKAVVFLEPQWYRVLEKDSVTLKCQGAYSPEDNSTQWFHNESLISSQASSYFIDAATVDDSGEYRCQTNLSTLSDPVQLEVHIGWLLLQAPRWVFKEEDPIHLRCHSWKNTALHKVTYLQNGKGRKYFHHNSDFYIPKATLKDSGSYFCRGLFGSKNVSSETVNITITQGLAVSTISSFFPPGYQ

Molecular Formula

2214 (Gene_ID) P08637 (G17-Q208) (Accession)

Molecular Weight

36-44 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD3e (CRIS-7), CF568 conjugate, 0.1mg/mL
BNC681050-500 1x 500 µL

CD3e (CRIS-7), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD106 / VCAM1 (B-K9), CF740 conjugate, 0.1mg/mL
BNC740304-500 1x 500 µL

CD106 / VCAM1 (B-K9), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TIMP2 (Tissue Inhibitor of Metalloproteinase 2) (TIMP2/2044), CF488A conjugate, 0.1mg/mL
BNC882044-500 1x 500 µL

TIMP2 (Tissue Inhibitor of Metalloproteinase 2) (TIMP2/2044), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
WIPI2 (2A2), CF488A conjugate, 0.1mg/mL
BNC882904-100 1x 100 µL

WIPI2 (2A2), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
AMACR / p504S (Prostate Cancer Marker) (AMACR/2748R), CF488A conjugate, 0.1mg/mL
BNC882748-500 1x 500 µL

AMACR / p504S (Prostate Cancer Marker) (AMACR/2748R), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
DOG-1 (DG1/447), CF488A conjugate, 0.1mg/mL
BNC880447-500 1x 500 µL

DOG-1 (DG1/447), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details