Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human CD226 antigen (CD226), partial (Active)

Product Specifications

Abbreviation

Recombinant Human CD226 protein, partial (Active)

Gene Name

CD226

UniProt

Q15762

Expression Region

19-247aa

Organism

Homo sapiens (Human)

Target Sequence

EEVLWHTSVPFAENMSLECVYPSMGILTQVEWFKIGTQQDSIAIFSPTHGMVIRKPYAERVYFLNSTMASNNMTLFFRNASEDDVGYYSCSLYTYPQGTWQKVIQVVQSDSFEAAVPSNSHIVSEPGKNVTLTCQPQMTWPVQAVRWEKIQPRQIDLLTYCNLVHGRNFTSKFPRQIVSNCSHGRWSVIVIPDVTVSDSGLYRCYLQASAGENETFVMRLTVAEGKTDN

Tag

C-terminal hFc1-Myc-tagged

Type

Active Protein & In Stock Protein

Source

Mammalian cell

Field of Research

Immunology

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Yes

Bioactivity

FACS assay shows that Human CD226 can bind to 293F cell overexpressing human CD155.

Form

Lyophilized powder

Buffer

Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

56.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

SAMD3 CRISPR Activation Plasmid (m2)
sc-435231-ACT-2 20 µg

SAMD3 CRISPR Activation Plasmid (m2)

Sign In for Pricing
View Details
Rabbit Polyclonal Syntaphilin Antibody [Biotin]
NBP2-98037B 0.1 mL

Rabbit Polyclonal Syntaphilin Antibody [Biotin]

Sign In for Pricing
View Details
NT-4 (Neurotrophin 4, Neurotrophin-4, NT4, Neutrophic Factor 4, NTF4, Neurotrophin 4/5, NT-4/5, NTF4/5, Neurotrophin 5, Neurotrophin-5, NT5, NT-5, Neutrophic Factor 5, NTF5)
MBS615657-01 0.5 mg

NT-4 (Neurotrophin 4, Neurotrophin-4, NT4, Neutrophic Factor 4, NTF4, Neurotrophin 4/5, NT-4/5, NTF4/5, Neurotrophin 5, Neurotrophin-5, NT5, NT-5, Neutrophic Factor 5, NTF5)

Sign In for Pricing
View Details
NT-4 (Neurotrophin 4, Neurotrophin-4, NT4, Neutrophic Factor 4, NTF4, Neurotrophin 4/5, NT-4/5, NTF4/5, Neurotrophin 5, Neurotrophin-5, NT5, NT-5, Neutrophic Factor 5, NTF5)
MBS615657-02 5x 0.5 mg

NT-4 (Neurotrophin 4, Neurotrophin-4, NT4, Neutrophic Factor 4, NTF4, Neurotrophin 4/5, NT-4/5, NTF4/5, Neurotrophin 5, Neurotrophin-5, NT5, NT-5, Neutrophic Factor 5, NTF5)

Sign In for Pricing
View Details
EP2 Double Nickase Plasmid (h)
sc-401464-NIC 20 µg

EP2 Double Nickase Plasmid (h)

Sign In for Pricing
View Details
D830030K20Rik sgRNA CRISPR Lentivector (Mouse) (Target 2)
K3041103 1.0 µg DNA

D830030K20Rik sgRNA CRISPR Lentivector (Mouse) (Target 2)

Sign In for Pricing
View Details