Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Fibroblast growth factor 22 (FGF22)

Product Specifications

Product Name Alternative

(FGF-22)

Abbreviation

Recombinant Human FGF22 protein

Gene Name

FGF22

UniProt

Q9HCT0

Expression Region

23-170aa

Organism

Homo sapiens (Human)

Target Sequence

TPSASRGPRSYPHLEGDVRWRRLFSSTHFFLRVDPGGRVQGTRWRHGQDSILEIRSVHVGVVVIKAVSSGFYVAMNRRGRLYGSRLYTVDCRFRERIEENGHNTYASQRWRRRGQPMFLALDRRGGPRPGGRTRRYHLSAHFLPVLVS

Tag

N-terminal 6xHis-SUMO-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Signal Transduction

Relevance

Plays a role in the fasting response, glucose homeostasis, lipolysis and lipogenesis. Can stimulate cell proliferation (in vitro) . May be involved in hair development.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

30.1 kDa

References & Citations

"Receptor specificity of the fibroblast growth factor family. The complete mammalian FGF family." Zhang X., Ibrahimi O.A., Olsen S.K., Umemori H., Mohammadi M., Ornitz D.M. J. Biol. Chem. 281:15694-15700 (2006)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GLP-2 Polyclonal Antibody, AbBy Fluor™ 488 Conjugated
bs-0208R-BF488 100 µL

GLP-2 Polyclonal Antibody, AbBy Fluor™ 488 Conjugated

Sign In for Pricing
View Details
Human TMEM176B Protein Lysate
MBS8428717-01 0.02 mg

Human TMEM176B Protein Lysate

Sign In for Pricing
View Details
Human TMEM176B Protein Lysate
MBS8428717-02 5x 0.02 mg

Human TMEM176B Protein Lysate

Sign In for Pricing
View Details
Rabbit Polyclonal West Nile Virus MP Antibody [CoraFluor 1]
NBP2-41053CL1 0.1 mL

Rabbit Polyclonal West Nile Virus MP Antibody [CoraFluor 1]

Sign In for Pricing
View Details
POU4F3 Antibody
orb1315248-01 30 µL

POU4F3 Antibody

Sign In for Pricing
View Details
POU4F3 Antibody
orb1315248-02 50 μL

POU4F3 Antibody

Sign In for Pricing
View Details