Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GMP OSM, Human (His)

OSM protein is a multifunctional growth regulator with dual functions of inhibiting tumor cell lines and stimulating the proliferation of AIDS-KS cells. It coordinates the production of cytokines, including IL-6, G-CSF, and GM-CSF, and binds to type I and type II OSM receptors, forming heterodimers with LIFR/IL6ST and OSMR/IL6ST, respectively. GMP OSM Protein, Human (His) is the recombinant human-derived OSM protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

GMP OSM Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/gmp-osm-protein-human-his.html

Purity

95.00

Smiles

AAIGSCSKEYRVLLGQLQKQTDLMQDTSRLLDPYIRIQGLDVPKLREHCRERPGAFPSEETLRGLGRRGFLQTLNATLGCVLHRLADLEQRLPKAQDLERSGLNIEDLEKLQMARPNILGLRNNIYCMAQLLDNSDTAEPTKAGRGASQPPTPTPASDAFQRKLEGCRFLHGYHRFMHSVGRVFSKWGESPNRSRR

Molecular Formula

5008 (Gene_ID) P13725 (A26-R221) (Accession)

Molecular Weight

Approximately 28 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SORL1 Polyclonal Antibody
MBS9133096-01 0.02 mL

SORL1 Polyclonal Antibody

Sign In for Pricing
View Details
SORL1 Polyclonal Antibody
MBS9133096-02 0.1 mL

SORL1 Polyclonal Antibody

Sign In for Pricing
View Details
SORL1 Polyclonal Antibody
MBS9133096-03 5x 0.1 mL

SORL1 Polyclonal Antibody

Sign In for Pricing
View Details
ATPase Inhibitory Factor 1 (ATPIF1) Rabbit Polyclonal Antibody
TA373851 100 µL

ATPase Inhibitory Factor 1 (ATPIF1) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
SCML1 (NM_001037535) Human Over-expression Lysate
LH04595V 100 µg

SCML1 (NM_001037535) Human Over-expression Lysate

Sign In for Pricing
View Details
Recombinant Human GALK1 Protein, His, E.coli-20ug
QP11927-20ug 20ug

Recombinant Human GALK1 Protein, His, E.coli-20ug

Sign In for Pricing
View Details