Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BID, Mouse (His)

BID Protein, a pro-apoptotic member of the Bcl-2 family, is initially discovered through binding to both pro-apoptotic Bax and anti-apoptotic Bcl-2. BID is activated in the BCL-2-regulated or mitochondrial apoptosis pathway and acts as a switch between the extrinsic and intrinsic cell death pathways. BID is susceptible to proteolytic cleavage by caspases, calpains, Granzyme B and cathepsins. BID Protein, Mouse (His) is the recombinant mouse-derived BID protein, expressed by E. coli , with C-His labeled tag.

Product Specifications

Product Name Alternative

BID Protein, Mouse (His), Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/bid-protein-mouse-his.html

Purity

95.0

Smiles

AGSAWSYTACAMDSEVSNGSGLGAKHITDLLVFGFLQSSGCTRQELEVLGRELPVQAYWEADLEDELQTDGSQASRSFNQGRIEPDSESQEEIIHNIARHLAQIGDEMDHNIQPTLVRQLAAQFMNGSLSEEDKRNCLAKALDEVKTAFPRDMENDKAMLIMTMLLAKKVASHAPSLLRDVFHTTVNFINQNLFS

Molecular Formula

12122 (Gene_ID) EDK99650.1 (A1-S195) (Accession)

Molecular Weight

Approximately 22.72 kDa

References & Citations

[1]Billen LP, et al. Bid: a Bax-like BH3 protein. Oncogene. 2008 Dec;27 Suppl 1:S93-104.|[2]Yin XM. Bid, a BH3-only multi-functional molecule, is at the cross road of life and death. Gene. 2006 Mar 15;369:7-19.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GYPB (NM_002100) Human Over-expression Lysate
LY419536 100 µg

GYPB (NM_002100) Human Over-expression Lysate

Sign In for Pricing
View Details
MECR Human Gene Knockout Kit (CRISPR)
KN400030 1 Kit

MECR Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Lung Specific Antigen (LSA120), CF568 conjugate, 0.1mg/mL
BNC680120-500 1x 500 µL

Lung Specific Antigen (LSA120), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Collagen IV Antibody
8C0157-AAT 50 µg

Collagen IV Antibody

Sign In for Pricing
View Details
PCDH20 Polyclonal Antibody
E-AB-90162-01 60 µL

PCDH20 Polyclonal Antibody

Sign In for Pricing
View Details
PCDH20 Polyclonal Antibody
E-AB-90162-02 120 µL

PCDH20 Polyclonal Antibody

Sign In for Pricing
View Details