Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OSM, Human (His)

OSM protein is a multifunctional growth regulator with dual functions of inhibiting tumor cell lines and stimulating the proliferation of AIDS-KS cells. It coordinates the production of cytokines, including IL-6, G-CSF, and GM-CSF, and binds to type I and type II OSM receptors, forming heterodimers with LIFR/IL6ST and OSMR/IL6ST, respectively. OSM Protein, Human (His) is the recombinant human-derived OSM protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

OSM Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/osm-protein-human-his.html

Purity

98.0

Smiles

AAIGSCSKEYRVLLGQLQKQTDLMQDTSRLLDPYIRIQGLDVPKLREHCRERPGAFPSEETLRGLGRRGFLQTLNATLGCVLHRLADLEQRLPKAQDLERSGLNIEDLEKLQMARPNILGLRNNIYCMAQLLDNSDTAEPTKAGRGASQPPTPTPASDAFQRKLEGCRFLHGYHRFMHSVGRVFSKWGESPNRSRR

Molecular Formula

5008 (Gene_ID) P13725 (A26-R221) (Accession)

Molecular Weight

Approximately 28 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ARH3 (ADPRHL2) (NM_017825) Human Over-expression Lysate
LY402619 100 µg

ARH3 (ADPRHL2) (NM_017825) Human Over-expression Lysate

Sign In for Pricing
View Details
Laminin alpha 4 (LAMA4) Mouse Monoclonal Antibody [Clone ID: OTI5G8]
CF805721 100 µg

Laminin alpha 4 (LAMA4) Mouse Monoclonal Antibody [Clone ID: OTI5G8]

Sign In for Pricing
View Details
Mouse Got1 activation kit by CRISPRa
GA201679 1 Kit

Mouse Got1 activation kit by CRISPRa

Sign In for Pricing
View Details
TRPC5 Mouse Monoclonal Antibody [Clone ID: N67/15]
75-104 100 µL

TRPC5 Mouse Monoclonal Antibody [Clone ID: N67/15]

Sign In for Pricing
View Details
2,5-Bis(4-hydroxyphenyl)piperazine Dihydrochloride
TRC-B447350-500MG 500 mg

2,5-Bis(4-hydroxyphenyl)piperazine Dihydrochloride

Sign In for Pricing
View Details
NOLC1 Recombinant Rabbit Monoclonal Antibody [JE65-16]
HA721113 100 µL

NOLC1 Recombinant Rabbit Monoclonal Antibody [JE65-16]

Sign In for Pricing
View Details