Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OSM, Human (His)

OSM protein is a multifunctional growth regulator with dual functions of inhibiting tumor cell lines and stimulating the proliferation of AIDS-KS cells. It coordinates the production of cytokines, including IL-6, G-CSF, and GM-CSF, and binds to type I and type II OSM receptors, forming heterodimers with LIFR/IL6ST and OSMR/IL6ST, respectively. OSM Protein, Human (His) is the recombinant human-derived OSM protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

OSM Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/osm-protein-human-his.html

Purity

98.0

Smiles

AAIGSCSKEYRVLLGQLQKQTDLMQDTSRLLDPYIRIQGLDVPKLREHCRERPGAFPSEETLRGLGRRGFLQTLNATLGCVLHRLADLEQRLPKAQDLERSGLNIEDLEKLQMARPNILGLRNNIYCMAQLLDNSDTAEPTKAGRGASQPPTPTPASDAFQRKLEGCRFLHGYHRFMHSVGRVFSKWGESPNRSRR

Molecular Formula

5008 (Gene_ID) P13725 (A26-R221) (Accession)

Molecular Weight

Approximately 28 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Isg20 (NM_020583) Mouse Tagged ORF Clone
MG201635 10 µg

Isg20 (NM_020583) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
ReadiCleave™ iFluor® 594 AML-NHS ester
7007-AAT 1 mg

ReadiCleave™ iFluor® 594 AML-NHS ester

Sign In for Pricing
View Details
Colloidal Gold Conjugated Goat Affinity Purified Antibody to Human Kappa (Free & Bound),  15nm
GAF-007-15 1 mL

Colloidal Gold Conjugated Goat Affinity Purified Antibody to Human Kappa (Free & Bound), 15nm

Sign In for Pricing
View Details
Horseradish Peroxidase Conjugated Goat Affinity Purified Antibody to Mouse Immunoglobulins
HAF-447-1 1 mL

Horseradish Peroxidase Conjugated Goat Affinity Purified Antibody to Mouse Immunoglobulins

Sign In for Pricing
View Details
Semaphorin 3E (SEMA3E) Human Gene Knockout Kit (CRISPR)
KN416038 1 Kit

Semaphorin 3E (SEMA3E) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Adjustable Glass-Injection Dispenser BPIP-202
BPIP-202 1 Unit

Adjustable Glass-Injection Dispenser BPIP-202

Sign In for Pricing
View Details