Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OSM, Human (His)

OSM protein is a multifunctional growth regulator with dual functions of inhibiting tumor cell lines and stimulating the proliferation of AIDS-KS cells. It coordinates the production of cytokines, including IL-6, G-CSF, and GM-CSF, and binds to type I and type II OSM receptors, forming heterodimers with LIFR/IL6ST and OSMR/IL6ST, respectively. OSM Protein, Human (His) is the recombinant human-derived OSM protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

OSM Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/osm-protein-human-his.html

Purity

98.0

Smiles

AAIGSCSKEYRVLLGQLQKQTDLMQDTSRLLDPYIRIQGLDVPKLREHCRERPGAFPSEETLRGLGRRGFLQTLNATLGCVLHRLADLEQRLPKAQDLERSGLNIEDLEKLQMARPNILGLRNNIYCMAQLLDNSDTAEPTKAGRGASQPPTPTPASDAFQRKLEGCRFLHGYHRFMHSVGRVFSKWGESPNRSRR

Molecular Formula

5008 (Gene_ID) P13725 (A26-R221) (Accession)

Molecular Weight

Approximately 28 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NEDL2 (HECW2) (NM_020760) Human Recombinant Protein
TP316544M 100 µg

NEDL2 (HECW2) (NM_020760) Human Recombinant Protein

Sign In for Pricing
View Details
CSF2RB Antibody
CSB-PA003029-01 50 µg

CSF2RB Antibody

Sign In for Pricing
View Details
CSF2RB Antibody
CSB-PA003029-02 100 µg

CSF2RB Antibody

Sign In for Pricing
View Details
CHO-K1/HEK293 Cells Stable expressing GPCR protein ADRA2C (Protein accession # NM_000683)
cAP-1035 1 Frozen Vial

CHO-K1/HEK293 Cells Stable expressing GPCR protein ADRA2C (Protein accession # NM_000683)

Sign In for Pricing
View Details
Mouse Monoclonal Erythropoietin Antibody (EPO/1367) [DyLight 350]
NBP2-54447UV 100 µL

Mouse Monoclonal Erythropoietin Antibody (EPO/1367) [DyLight 350]

Sign In for Pricing
View Details
Purified anti-human SSEA-5
GT13519 50 µg

Purified anti-human SSEA-5

Sign In for Pricing
View Details