CD299, Human (HEK293, hFc, solution)
The CD299 protein is an important C-type lectin that plays a role in cell adhesion and pathogen recognition. It can identify pathogens such as Mycobacterium tuberculosis, Ebola virus, hepatitis C, HIV-1, influenza A, West Nile virus and SARS-CoV. CD299 Protein, Human (HEK293, hFc, solution) is the recombinant human-derived CD299 protein, expressed by HEK293 , with N-hFc labeled tag.
Product Specifications
Product Name Alternative
CD299 Protein, Human (HEK293, hFc, solution), Human, HEK293
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/cd299-protein-human-hek293-fc.html
Purity
90.0
Smiles
SLSQEQSEQDAIYQNLTQLKAAVGELSEKSKLQEIYQELTQLKAAVGELPEKSKLQEIYQELTRLKAAVGELPEKSKLQEIYQELTRLKAAVGELPEKSKLQEIYQELTRLKAAVGELPEKSKLQEIYQELTELKAAVGELPEKSKLQEIYQELTQLKAAVGELPDQSKQQQIYQELTDLKTAFERLCRHCPKDWTFFQGNCYFMSNSQRNWHDSVTACQEVRAQLVVIKTAEEQNFLQLQTSRSNRFSWMGLSDLNQEGTWQWVDGSPLSPSFQRYWNSGEPNNSGNEDCAEFSGSGWNDNRCDVDNYWICKKPAACFRDE
Molecular Formula
10332 (Gene_ID) Q9H2X3-1/NP_055072.3 (S78-E399) (Accession)
Molecular Weight
65.83 KDa, due to glycosylation
Shipping Conditions
Dry ice.
Storage Conditions
Stored at -80°C for 1 year
Scientific Category
Recombinant Proteins
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS3809491-03 5x 96 Well
Rat Macrophage-Derived Chemokine ELISA Kit
Sign In for Pricing
View Details MBS3809491-04 10x 96 Well
Rat Macrophage-Derived Chemokine ELISA Kit
Sign In for Pricing
View Details H1830-53P-ML490 100 µL
HSP27 (Ser82) (Heat Shock Protein beta-1, HspB1, Heat Shock 27kD Protein, HSP 27, Stress-responsive Protein 27, SRP27, Estrogen-regulated 24kD Protein, 28kD Heat Shock Protein, HSPB1, HSP28) (MaxLight 490) discontinued
Sign In for Pricing
View Details 