Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD299, Human (HEK293, hFc, solution)

The CD299 protein is an important C-type lectin that plays a role in cell adhesion and pathogen recognition. It can identify pathogens such as Mycobacterium tuberculosis, Ebola virus, hepatitis C, HIV-1, influenza A, West Nile virus and SARS-CoV. CD299 Protein, Human (HEK293, hFc, solution) is the recombinant human-derived CD299 protein, expressed by HEK293 , with N-hFc labeled tag.

Product Specifications

Product Name Alternative

CD299 Protein, Human (HEK293, hFc, solution), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd299-protein-human-hek293-fc.html

Purity

90.0

Smiles

SLSQEQSEQDAIYQNLTQLKAAVGELSEKSKLQEIYQELTQLKAAVGELPEKSKLQEIYQELTRLKAAVGELPEKSKLQEIYQELTRLKAAVGELPEKSKLQEIYQELTRLKAAVGELPEKSKLQEIYQELTELKAAVGELPEKSKLQEIYQELTQLKAAVGELPDQSKQQQIYQELTDLKTAFERLCRHCPKDWTFFQGNCYFMSNSQRNWHDSVTACQEVRAQLVVIKTAEEQNFLQLQTSRSNRFSWMGLSDLNQEGTWQWVDGSPLSPSFQRYWNSGEPNNSGNEDCAEFSGSGWNDNRCDVDNYWICKKPAACFRDE

Molecular Formula

10332 (Gene_ID) Q9H2X3-1/NP_055072.3 (S78-E399) (Accession)

Molecular Weight

65.83 KDa, due to glycosylation

Shipping Conditions

Dry ice.

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Biotin-Linked Polyclonal Antibody to Claudin 1 (CLDN1)
MBS2113481-01 0.1 mL

Biotin-Linked Polyclonal Antibody to Claudin 1 (CLDN1)

Sign In for Pricing
View Details
Biotin-Linked Polyclonal Antibody to Claudin 1 (CLDN1)
MBS2113481-02 0.2 mL

Biotin-Linked Polyclonal Antibody to Claudin 1 (CLDN1)

Sign In for Pricing
View Details
Biotin-Linked Polyclonal Antibody to Claudin 1 (CLDN1)
MBS2113481-03 0.5 mL

Biotin-Linked Polyclonal Antibody to Claudin 1 (CLDN1)

Sign In for Pricing
View Details
Biotin-Linked Polyclonal Antibody to Claudin 1 (CLDN1)
MBS2113481-04 1 mL

Biotin-Linked Polyclonal Antibody to Claudin 1 (CLDN1)

Sign In for Pricing
View Details
Biotin-Linked Polyclonal Antibody to Claudin 1 (CLDN1)
MBS2113481-05 5 mL

Biotin-Linked Polyclonal Antibody to Claudin 1 (CLDN1)

Sign In for Pricing
View Details
Biotin-Linked Polyclonal Antibody to Claudin 1 (CLDN1)
MBS2113481-06 5x 5 mL

Biotin-Linked Polyclonal Antibody to Claudin 1 (CLDN1)

Sign In for Pricing
View Details