Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD299, Human (HEK293, hFc, solution)

The CD299 protein is an important C-type lectin that plays a role in cell adhesion and pathogen recognition. It can identify pathogens such as Mycobacterium tuberculosis, Ebola virus, hepatitis C, HIV-1, influenza A, West Nile virus and SARS-CoV. CD299 Protein, Human (HEK293, hFc, solution) is the recombinant human-derived CD299 protein, expressed by HEK293 , with N-hFc labeled tag.

Product Specifications

Product Name Alternative

CD299 Protein, Human (HEK293, hFc, solution), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd299-protein-human-hek293-fc.html

Purity

90.0

Smiles

SLSQEQSEQDAIYQNLTQLKAAVGELSEKSKLQEIYQELTQLKAAVGELPEKSKLQEIYQELTRLKAAVGELPEKSKLQEIYQELTRLKAAVGELPEKSKLQEIYQELTRLKAAVGELPEKSKLQEIYQELTELKAAVGELPEKSKLQEIYQELTQLKAAVGELPDQSKQQQIYQELTDLKTAFERLCRHCPKDWTFFQGNCYFMSNSQRNWHDSVTACQEVRAQLVVIKTAEEQNFLQLQTSRSNRFSWMGLSDLNQEGTWQWVDGSPLSPSFQRYWNSGEPNNSGNEDCAEFSGSGWNDNRCDVDNYWICKKPAACFRDE

Molecular Formula

10332 (Gene_ID) Q9H2X3-1/NP_055072.3 (S78-E399) (Accession)

Molecular Weight

65.83 KDa, due to glycosylation

Shipping Conditions

Dry ice.

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit anti-Saccharomyces cerevisiae (strain 204508/S288c)(Baker's yeast) YBL029C-A Polyclonal Antibody
MBS7193992 Inquire

Rabbit anti-Saccharomyces cerevisiae (strain 204508/S288c)(Baker's yeast) YBL029C-A Polyclonal Antibody

Sign In for Pricing
View Details
Olfr684 Double Nickase Plasmid (m2)
sc-434047-NIC-2 20 µg

Olfr684 Double Nickase Plasmid (m2)

Sign In for Pricing
View Details
Physalin B
HY-N7695 1 mg

Physalin B

Sign In for Pricing
View Details
HLF (Hepatic Leukemia Factor, MGC33822) (MaxLight 550)
247130-ML550 100 µL

HLF (Hepatic Leukemia Factor, MGC33822) (MaxLight 550)

Sign In for Pricing
View Details
PAP (Plasmin/Antiplasmin Complex)
053363 200 µL

PAP (Plasmin/Antiplasmin Complex)

Sign In for Pricing
View Details
Rabbit Polyclonal MAB21L3 Antibody
NBP2-55489 100 µL

Rabbit Polyclonal MAB21L3 Antibody

Sign In for Pricing
View Details