Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Inhibin beta C chain (Inhbc)

Product Specifications

Product Name Alternative

Activin beta-C chain

Abbreviation

Recombinant Rat Inhbc protein

Gene Name

Inhbc

UniProt

Q9WUK5

Expression Region

237-351aa

Organism

Rattus norvegicus (Rat)

Target Sequence

INCQGLSRMCCRQEFFVDFREIGWHDWIIQPEGYAMNFCTGQCPLHVAGMPGISASFHTAVLNLLKANTDAGTARRGSCCVPTSRRPLSLLYYDRDSNIVKTDIPDMVVEACGCS

Tag

C-terminal 10xHis-HSA-tagged

Type

Developed Protein

Source

Mammalian cell

Field of Research

Neuroscience

Relevance

Inhibins and activins inhibit and activate, respectively, the secretion of follitropin by the pituitary gland. Inhibins/activins are involved in regulating a number of diverse functions such as hypothalamic and pituitary hormone secretion, gonadal hormone secretion, germ cell development and maturation, erythroid differentiation, insulin secretion, nerve cell survival, embryonic axial development or bone growth, depending on their subunit composition. Inhibins appear to oppose the functions of activins.

Endotoxin

Not test

Purity

Greater than 95% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

80.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Olfactory receptor 1B1 Antibody
G515-01 50 μL

Olfactory receptor 1B1 Antibody

Sign In for Pricing
View Details
Olfactory receptor 1B1 Antibody
G515-02 100 µL

Olfactory receptor 1B1 Antibody

Sign In for Pricing
View Details
Sestrin 2 discontinued
381453 200 µL

Sestrin 2 discontinued

Sign In for Pricing
View Details
Rabbit Polyclonal PHPT1 Antibody [DyLight 350]
NBP3-18414UV 0.1 mL

Rabbit Polyclonal PHPT1 Antibody [DyLight 350]

Sign In for Pricing
View Details
Bovine Visfatin (VF) ELISA Kit
RDR-VF-b-96Tests 96 Tests

Bovine Visfatin (VF) ELISA Kit

Sign In for Pricing
View Details
Rabbit Polyclonal NCOR1 Antibody
NBP2-48997-25ul 25 µL

Rabbit Polyclonal NCOR1 Antibody

Sign In for Pricing
View Details