Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GDF-8, Human/Mouse/Rat (HEK293)

GDF-8 (Growth Differentiation Factor 8) functions as a specific negative regulator of skeletal muscle growth. It forms homodimers linked by disulfide bonds and inhibits WFIKKN2 activity through interaction. GDF-8 also interacts with FST3, playing a regulatory role in skeletal muscle growth modulation. GDF-8 Protein, Human/Mouse/Rat (HEK293) is the recombinant rat-derived GDF-8 protein, expressed by HEK293 , with tag free.

Product Specifications

Product Name Alternative

GDF-8 Protein, Human/Mouse/Rat (HEK293), Rat; Human; Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/gdf-8-protein-human-mouse-rat-hek-293.html

Purity

98.0

Smiles

KRSRRDFGLDCDEHSTESRCCRYPLTVDFEAFGWDWIIAPKRYKANYCSGECEFVFLQKYPHTHLVHQANPRGSAGPCCTPTKMSPINMLYFNGKEQIIYGKIPAMVVDRCGCS

Molecular Formula

2660 (Gene_ID) O14793 (K262-S375) (Accession)

Molecular Weight

Approximately 12-15 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

HDC Protein (C-His, Human)
P504545 100 µg

HDC Protein (C-His, Human)

Sign In for Pricing
View Details
Rabbit Polyclonal P2Y14/GPR105 Antibody
NBP3-14438 50 µg

Rabbit Polyclonal P2Y14/GPR105 Antibody

Sign In for Pricing
View Details
RPL7AP6 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)
K1881907 1.0 µg DNA

RPL7AP6 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
ACSL3, CT (ACSL3, ACS3, FACL3, LACS3, Long-chain-fatty-acid-CoA ligase 3, Long-chain acyl-CoA synthetase 3) (MaxLight 650) discontinued
031559-ML650 100 µL

ACSL3, CT (ACSL3, ACS3, FACL3, LACS3, Long-chain-fatty-acid-CoA ligase 3, Long-chain acyl-CoA synthetase 3) (MaxLight 650) discontinued

Sign In for Pricing
View Details
Rabbit Kallikrein 11 (KLK11) ELISA Kit
EIA05940Rb 1 Kit

Rabbit Kallikrein 11 (KLK11) ELISA Kit

Sign In for Pricing
View Details
Lentiviral mouse Pfas shRNA (UAS) - Lentiviral mouse Pfas shRNA (UAS) (25)
GTR15238229 1 Vial

Lentiviral mouse Pfas shRNA (UAS) - Lentiviral mouse Pfas shRNA (UAS) (25)

Sign In for Pricing
View Details