Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GDF-8, Human/Mouse/Rat (HEK293)

GDF-8 (Growth Differentiation Factor 8) functions as a specific negative regulator of skeletal muscle growth. It forms homodimers linked by disulfide bonds and inhibits WFIKKN2 activity through interaction. GDF-8 also interacts with FST3, playing a regulatory role in skeletal muscle growth modulation. GDF-8 Protein, Human/Mouse/Rat (HEK293) is the recombinant rat-derived GDF-8 protein, expressed by HEK293 , with tag free.

Product Specifications

Product Name Alternative

GDF-8 Protein, Human/Mouse/Rat (HEK293), Rat; Human; Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/gdf-8-protein-human-mouse-rat-hek-293.html

Purity

98.0

Smiles

KRSRRDFGLDCDEHSTESRCCRYPLTVDFEAFGWDWIIAPKRYKANYCSGECEFVFLQKYPHTHLVHQANPRGSAGPCCTPTKMSPINMLYFNGKEQIIYGKIPAMVVDRCGCS

Molecular Formula

2660 (Gene_ID) O14793 (K262-S375) (Accession)

Molecular Weight

Approximately 12-15 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

GLYATL1 ORF Vector (Human) (pORF)
ORF004463 1.0 µg DNA

GLYATL1 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
anti-F box protein 38
YF-PA21138 50 ug

anti-F box protein 38

Sign In for Pricing
View Details
Sbf2 ORF Vector (Mouse) (pORF)
ORF056691 1.0 µg DNA

Sbf2 ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details
Interleukin 17F (IL-17F) BioAssayTM ECL ELISA Kit (Human)
157875 96 Tests

Interleukin 17F (IL-17F) BioAssayTM ECL ELISA Kit (Human)

Sign In for Pricing
View Details
GALR3
400466-01 50 µL

GALR3

Sign In for Pricing
View Details
GALR3
400466-02 100 µL

GALR3

Sign In for Pricing
View Details