Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GDF-8, Human/Mouse/Rat (HEK293)

GDF-8 (Growth Differentiation Factor 8) functions as a specific negative regulator of skeletal muscle growth. It forms homodimers linked by disulfide bonds and inhibits WFIKKN2 activity through interaction. GDF-8 also interacts with FST3, playing a regulatory role in skeletal muscle growth modulation. GDF-8 Protein, Human/Mouse/Rat (HEK293) is the recombinant rat-derived GDF-8 protein, expressed by HEK293 , with tag free.

Product Specifications

Product Name Alternative

GDF-8 Protein, Human/Mouse/Rat (HEK293), Rat; Human; Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/gdf-8-protein-human-mouse-rat-hek-293.html

Purity

98.0

Smiles

KRSRRDFGLDCDEHSTESRCCRYPLTVDFEAFGWDWIIAPKRYKANYCSGECEFVFLQKYPHTHLVHQANPRGSAGPCCTPTKMSPINMLYFNGKEQIIYGKIPAMVVDRCGCS

Molecular Formula

2660 (Gene_ID) O14793 (K262-S375) (Accession)

Molecular Weight

Approximately 12-15 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

E3 Ubiquitin-Protein Ligase SIAH1 (SIAH1) Peptide
abx269101 100 µg

E3 Ubiquitin-Protein Ligase SIAH1 (SIAH1) Peptide

Sign In for Pricing
View Details
pCMV-SPORT6-Nudt6 Plasmid
PVT54241 2 µg

pCMV-SPORT6-Nudt6 Plasmid

Sign In for Pricing
View Details
Rabbit Polyclonal SF3B5 Antibody
NBP2-94370-0.02mL 0.02 mL

Rabbit Polyclonal SF3B5 Antibody

Sign In for Pricing
View Details
SEC11A Adenovirus (Rat)
43282056 1.0 mL

SEC11A Adenovirus (Rat)

Sign In for Pricing
View Details
SµLt1c3 Rat shRNA Plasmid (Locus ID 65185)
TR711529 1 Kit

SµLt1c3 Rat shRNA Plasmid (Locus ID 65185)

Sign In for Pricing
View Details
Chicken Cardiac Troponin C ELISA Kit
MBS7264630-01 48 Well

Chicken Cardiac Troponin C ELISA Kit

Sign In for Pricing
View Details