Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GDF-8, Human/Mouse/Rat (HEK293)

GDF-8 (Growth Differentiation Factor 8) functions as a specific negative regulator of skeletal muscle growth. It forms homodimers linked by disulfide bonds and inhibits WFIKKN2 activity through interaction. GDF-8 also interacts with FST3, playing a regulatory role in skeletal muscle growth modulation. GDF-8 Protein, Human/Mouse/Rat (HEK293) is the recombinant rat-derived GDF-8 protein, expressed by HEK293 , with tag free.

Product Specifications

Product Name Alternative

GDF-8 Protein, Human/Mouse/Rat (HEK293), Rat; Human; Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/gdf-8-protein-human-mouse-rat-hek-293.html

Purity

98.0

Smiles

KRSRRDFGLDCDEHSTESRCCRYPLTVDFEAFGWDWIIAPKRYKANYCSGECEFVFLQKYPHTHLVHQANPRGSAGPCCTPTKMSPINMLYFNGKEQIIYGKIPAMVVDRCGCS

Molecular Formula

2660 (Gene_ID) O14793 (K262-S375) (Accession)

Molecular Weight

Approximately 12-15 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Staphylococcus Aureus hld Protein (aa 1-26) (strain MSSA476)
VAng-Cr5811-500gEcoli 500 µg (E. coli)

Recombinant Staphylococcus Aureus hld Protein (aa 1-26) (strain MSSA476)

Sign In for Pricing
View Details
Samd7 (NM_029489) Mouse Tagged ORF Clone Lentiviral Particle
MR217543L4V 200 µL

Samd7 (NM_029489) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Recombinant Human RNA-binding protein 10 (RBM10) , partial
MBS958684 Inquire

Recombinant Human RNA-binding protein 10 (RBM10) , partial

Sign In for Pricing
View Details
OCLN, CT (OCLN, Occludin) (FITC) discontinued
039252-FITC 200 µL

OCLN, CT (OCLN, Occludin) (FITC) discontinued

Sign In for Pricing
View Details
CD147 (BSG) (NM_001728) Human Tagged ORF Clone Lentiviral Particle
RC219464L1V 200 µL

CD147 (BSG) (NM_001728) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Urine, Human, Female
MBS641014-01 50 mL

Urine, Human, Female

Sign In for Pricing
View Details