Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GDF-8, Human/Mouse/Rat (HEK293)

GDF-8 (Growth Differentiation Factor 8) functions as a specific negative regulator of skeletal muscle growth. It forms homodimers linked by disulfide bonds and inhibits WFIKKN2 activity through interaction. GDF-8 also interacts with FST3, playing a regulatory role in skeletal muscle growth modulation. GDF-8 Protein, Human/Mouse/Rat (HEK293) is the recombinant rat-derived GDF-8 protein, expressed by HEK293 , with tag free.

Product Specifications

Product Name Alternative

GDF-8 Protein, Human/Mouse/Rat (HEK293), Rat; Human; Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/gdf-8-protein-human-mouse-rat-hek-293.html

Purity

98.0

Smiles

KRSRRDFGLDCDEHSTESRCCRYPLTVDFEAFGWDWIIAPKRYKANYCSGECEFVFLQKYPHTHLVHQANPRGSAGPCCTPTKMSPINMLYFNGKEQIIYGKIPAMVVDRCGCS

Molecular Formula

2660 (Gene_ID) O14793 (K262-S375) (Accession)

Molecular Weight

Approximately 12-15 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Zfp239 (NM_008616) Mouse Tagged Lenti ORF Clone
MR202057L4 10 µg

Zfp239 (NM_008616) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
KLF8 Rabbit Polyclonal Antibody
TA344524 100 µL

KLF8 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
FTLP7 Protein Vector (Human) (pPB-N-His)
PV079670 500 ng

FTLP7 Protein Vector (Human) (pPB-N-His)

Sign In for Pricing
View Details
4-Oxocyclohexanecarboxylic Acid
161552 1 g

4-Oxocyclohexanecarboxylic Acid

Sign In for Pricing
View Details
Sodium 2-((2-Aminoethyl)amino)ethanesulfonate
TRC-S612005-5G 5 g

Sodium 2-((2-Aminoethyl)amino)ethanesulfonate

Sign In for Pricing
View Details
RFP Expressing Monkey Primary Small Intestinal Epithelial Cells
NHFF-1123-HX418 Each

RFP Expressing Monkey Primary Small Intestinal Epithelial Cells

Sign In for Pricing
View Details