Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GDF-8, Human/Mouse/Rat (HEK293)

GDF-8 (Growth Differentiation Factor 8) functions as a specific negative regulator of skeletal muscle growth. It forms homodimers linked by disulfide bonds and inhibits WFIKKN2 activity through interaction. GDF-8 also interacts with FST3, playing a regulatory role in skeletal muscle growth modulation. GDF-8 Protein, Human/Mouse/Rat (HEK293) is the recombinant rat-derived GDF-8 protein, expressed by HEK293 , with tag free.

Product Specifications

Product Name Alternative

GDF-8 Protein, Human/Mouse/Rat (HEK293), Rat; Human; Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/gdf-8-protein-human-mouse-rat-hek-293.html

Purity

98.0

Smiles

KRSRRDFGLDCDEHSTESRCCRYPLTVDFEAFGWDWIIAPKRYKANYCSGECEFVFLQKYPHTHLVHQANPRGSAGPCCTPTKMSPINMLYFNGKEQIIYGKIPAMVVDRCGCS

Molecular Formula

2660 (Gene_ID) O14793 (K262-S375) (Accession)

Molecular Weight

Approximately 12-15 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

KIAA0494 Recombinant Protein (Human)
RP016822 100 µg

KIAA0494 Recombinant Protein (Human)

Sign In for Pricing
View Details
Thymidylate Synthase (dTMP synthase, TMS, TS, TSase, TYMS protein, Tyms thymidylate synthetase) (Biotin)
MBS6123726-01 0.1 mL

Thymidylate Synthase (dTMP synthase, TMS, TS, TSase, TYMS protein, Tyms thymidylate synthetase) (Biotin)

Sign In for Pricing
View Details
Thymidylate Synthase (dTMP synthase, TMS, TS, TSase, TYMS protein, Tyms thymidylate synthetase) (Biotin)
MBS6123726-02 5x 0.1 mL

Thymidylate Synthase (dTMP synthase, TMS, TS, TSase, TYMS protein, Tyms thymidylate synthetase) (Biotin)

Sign In for Pricing
View Details
Collagen VI Alpha 2 (COL6A2) Antibody
abx377642-01 50 µg

Collagen VI Alpha 2 (COL6A2) Antibody

Sign In for Pricing
View Details
Collagen VI Alpha 2 (COL6A2) Antibody
abx377642-02 100 µg

Collagen VI Alpha 2 (COL6A2) Antibody

Sign In for Pricing
View Details
CD3 (FITC) discontinued. see C2254-56D1
214654-FITC 100 µL

CD3 (FITC) discontinued. see C2254-56D1

Sign In for Pricing
View Details