Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GDF-8, Human/Mouse/Rat (HEK293)

GDF-8 (Growth Differentiation Factor 8) functions as a specific negative regulator of skeletal muscle growth. It forms homodimers linked by disulfide bonds and inhibits WFIKKN2 activity through interaction. GDF-8 also interacts with FST3, playing a regulatory role in skeletal muscle growth modulation. GDF-8 Protein, Human/Mouse/Rat (HEK293) is the recombinant rat-derived GDF-8 protein, expressed by HEK293 , with tag free.

Product Specifications

Product Name Alternative

GDF-8 Protein, Human/Mouse/Rat (HEK293), Rat; Human; Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/gdf-8-protein-human-mouse-rat-hek-293.html

Purity

98.0

Smiles

KRSRRDFGLDCDEHSTESRCCRYPLTVDFEAFGWDWIIAPKRYKANYCSGECEFVFLQKYPHTHLVHQANPRGSAGPCCTPTKMSPINMLYFNGKEQIIYGKIPAMVVDRCGCS

Molecular Formula

2660 (Gene_ID) O14793 (K262-S375) (Accession)

Molecular Weight

Approximately 12-15 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

NMNAT3 (NM_178177) Human Over-expression Lysate
LC406017 20 µg

NMNAT3 (NM_178177) Human Over-expression Lysate

Sign In for Pricing
View Details
Human OR51F2 Pre-designed siRNA Set B
SI011303B 1 Each

Human OR51F2 Pre-designed siRNA Set B

Sign In for Pricing
View Details
S-SuLfo-L-cysteine sodium salt
0162/50 50 mg

S-SuLfo-L-cysteine sodium salt

Sign In for Pricing
View Details
RAD23A ((UV Excision Repair Protein RAD23 Homolog A, HR23A, HHR23A)
368893 100 µL

RAD23A ((UV Excision Repair Protein RAD23 Homolog A, HR23A, HHR23A)

Sign In for Pricing
View Details
Anti-Robo3 Antibody FITC
STJ502785 100 µg

Anti-Robo3 Antibody FITC

Sign In for Pricing
View Details
Lentiviral mouse Abhd16b shRNA (UAS) - Lentiviral mouse Abhd16b shRNA (UAS, RFP) (25)
GTR15281819 1 Vial

Lentiviral mouse Abhd16b shRNA (UAS) - Lentiviral mouse Abhd16b shRNA (UAS, RFP) (25)

Sign In for Pricing
View Details