Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GDF-8, Human/Mouse/Rat (HEK293)

GDF-8 (Growth Differentiation Factor 8) functions as a specific negative regulator of skeletal muscle growth. It forms homodimers linked by disulfide bonds and inhibits WFIKKN2 activity through interaction. GDF-8 also interacts with FST3, playing a regulatory role in skeletal muscle growth modulation. GDF-8 Protein, Human/Mouse/Rat (HEK293) is the recombinant rat-derived GDF-8 protein, expressed by HEK293 , with tag free.

Product Specifications

Product Name Alternative

GDF-8 Protein, Human/Mouse/Rat (HEK293), Rat; Human; Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/gdf-8-protein-human-mouse-rat-hek-293.html

Purity

98.0

Smiles

KRSRRDFGLDCDEHSTESRCCRYPLTVDFEAFGWDWIIAPKRYKANYCSGECEFVFLQKYPHTHLVHQANPRGSAGPCCTPTKMSPINMLYFNGKEQIIYGKIPAMVVDRCGCS

Molecular Formula

2660 (Gene_ID) O14793 (K262-S375) (Accession)

Molecular Weight

Approximately 12-15 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

C4orf42 Protein Vector (Human) (pPM-C-His)
PV006512 500 ng

C4orf42 Protein Vector (Human) (pPM-C-His)

Sign In for Pricing
View Details
MUC20 siRNA (Human)
CRJ6272-01 15 nmol

MUC20 siRNA (Human)

Sign In for Pricing
View Details
MUC20 siRNA (Human)
CRJ6272-02 30 nmol

MUC20 siRNA (Human)

Sign In for Pricing
View Details
Rat Alanine aminotransferase (ALT) ELISA Kit
RK06385 96 Tests

Rat Alanine aminotransferase (ALT) ELISA Kit

Sign In for Pricing
View Details
Zdhhc22 3'UTR GFP Stable Cell Line
TU273626 1.0 mL

Zdhhc22 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Recombinant Mouse EPO-R/Epor Protein
RP01732-01 10 μg

Recombinant Mouse EPO-R/Epor Protein

Sign In for Pricing
View Details