Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GDF-8, Human/Mouse/Rat (HEK293)

GDF-8 (Growth Differentiation Factor 8) functions as a specific negative regulator of skeletal muscle growth. It forms homodimers linked by disulfide bonds and inhibits WFIKKN2 activity through interaction. GDF-8 also interacts with FST3, playing a regulatory role in skeletal muscle growth modulation. GDF-8 Protein, Human/Mouse/Rat (HEK293) is the recombinant rat-derived GDF-8 protein, expressed by HEK293 , with tag free.

Product Specifications

Product Name Alternative

GDF-8 Protein, Human/Mouse/Rat (HEK293), Rat; Human; Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/gdf-8-protein-human-mouse-rat-hek-293.html

Purity

98.0

Smiles

KRSRRDFGLDCDEHSTESRCCRYPLTVDFEAFGWDWIIAPKRYKANYCSGECEFVFLQKYPHTHLVHQANPRGSAGPCCTPTKMSPINMLYFNGKEQIIYGKIPAMVVDRCGCS

Molecular Formula

2660 (Gene_ID) O14793 (K262-S375) (Accession)

Molecular Weight

Approximately 12-15 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

HMGN2P38 Lentiviral Vector (Human) (UbC) (pLenti-GIII-UbC)
LV728331 1.0 µg DNA

HMGN2P38 Lentiviral Vector (Human) (UbC) (pLenti-GIII-UbC)

Sign In for Pricing
View Details
PDZD8 (PDZK8, PDZ Domain Containing 8, Sarcoma Antigen NY-SAR-104, BA129M16.2, Sarcoma Antigen NY-SAR- 84)
171126 50 µg

PDZD8 (PDZK8, PDZ Domain Containing 8, Sarcoma Antigen NY-SAR-104, BA129M16.2, Sarcoma Antigen NY-SAR- 84)

Sign In for Pricing
View Details
Mouse Monoclonal Galectin-3 Antibody (5C21) [Alexa Fluor 700]
NBP1-92690AF700 0.1 mL

Mouse Monoclonal Galectin-3 Antibody (5C21) [Alexa Fluor 700]

Sign In for Pricing
View Details
Mouse Angiotensin II (Ang II) ELISA Kit
abx153637-01 96 Tests

Mouse Angiotensin II (Ang II) ELISA Kit

Sign In for Pricing
View Details
Mouse Angiotensin II (Ang II) ELISA Kit
abx153637-02 5x 96 Tests

Mouse Angiotensin II (Ang II) ELISA Kit

Sign In for Pricing
View Details
Mouse Angiotensin II (Ang II) ELISA Kit
abx153637-03 10x 96 Tests

Mouse Angiotensin II (Ang II) ELISA Kit

Sign In for Pricing
View Details