GDF-8, Human/Mouse/Rat (HEK293)
GDF-8 (Growth Differentiation Factor 8) functions as a specific negative regulator of skeletal muscle growth. It forms homodimers linked by disulfide bonds and inhibits WFIKKN2 activity through interaction. GDF-8 also interacts with FST3, playing a regulatory role in skeletal muscle growth modulation. GDF-8 Protein, Human/Mouse/Rat (HEK293) is the recombinant rat-derived GDF-8 protein, expressed by HEK293 , with tag free.
Product Specifications
Product Name Alternative
GDF-8 Protein, Human/Mouse/Rat (HEK293), Rat; Human; Mouse, HEK293
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/gdf-8-protein-human-mouse-rat-hek-293.html
Purity
98.0
Smiles
KRSRRDFGLDCDEHSTESRCCRYPLTVDFEAFGWDWIIAPKRYKANYCSGECEFVFLQKYPHTHLVHQANPRGSAGPCCTPTKMSPINMLYFNGKEQIIYGKIPAMVVDRCGCS
Molecular Formula
2660 (Gene_ID) O14793 (K262-S375) (Accession)
Molecular Weight
Approximately 12-15 kDa, based on SDS-PAGE under reducing conditions.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Explore Other Products
Browse additional items from our catalog
Rabbit anti-human C-type lectin domain family 4 member D polyclonal Antibody
Rabbit anti-human C-type lectin domain family 4 member D polyclonal Antibody
Rabbit anti-human C-type lectin domain family 4 member D polyclonal Antibody
CCL3L1 (Chemokine C-C-Motif Ligand 3 Like Protein 1, CCL3-L1, LD78, SCYA3L, SCYA3L1, MIP1AP, MIP1-Alpha-P, Small Inducible Cytokine A3-Like 1, Macrophage Inflammatory Protein 1-Alpha-P, Tonsillar Lymphocyte LD78 Beta)
