Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GDF-8, Human/Mouse/Rat (HEK293)

GDF-8 (Growth Differentiation Factor 8) functions as a specific negative regulator of skeletal muscle growth. It forms homodimers linked by disulfide bonds and inhibits WFIKKN2 activity through interaction. GDF-8 also interacts with FST3, playing a regulatory role in skeletal muscle growth modulation. GDF-8 Protein, Human/Mouse/Rat (HEK293) is the recombinant rat-derived GDF-8 protein, expressed by HEK293 , with tag free.

Product Specifications

Product Name Alternative

GDF-8 Protein, Human/Mouse/Rat (HEK293), Rat; Human; Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/gdf-8-protein-human-mouse-rat-hek-293.html

Purity

98.0

Smiles

KRSRRDFGLDCDEHSTESRCCRYPLTVDFEAFGWDWIIAPKRYKANYCSGECEFVFLQKYPHTHLVHQANPRGSAGPCCTPTKMSPINMLYFNGKEQIIYGKIPAMVVDRCGCS

Molecular Formula

2660 (Gene_ID) O14793 (K262-S375) (Accession)

Molecular Weight

Approximately 12-15 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cytokeratin 8/18 (C-51), CF568 conjugate, 0.1mg/mL
BNC680034-100 1x 100 µL

Cytokeratin 8/18 (C-51), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD44 Standard (156-3C11), CF740 conjugate, 0.1mg/mL
BNC740460-100 1x 100 µL

CD44 Standard (156-3C11), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TYRP1 (Tyrosinase Related Protein 1) (TA99), CF594 conjugate, 0.1mg/mL
BNC940806-500 1x 500 µL

TYRP1 (Tyrosinase Related Protein 1) (TA99), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Major Vault Protein (MVP) (1032), CF640R conjugate, 0.1mg/mL
BNC400225-500 1x 500 µL

Major Vault Protein (MVP) (1032), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD20 (B9E9), CF488A conjugate, 0.1mg/mL
BNC880160-100 1x 100 µL

CD20 (B9E9), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Fibronectin (Fn-3), CF568 conjugate, 0.1mg/mL
BNC682848-100 1x 100 µL

Fibronectin (Fn-3), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details