Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Danio rerio Protein DVR-1 (dvr1)

Product Specifications

Product Name Alternative

Dvr-1, vg1

Abbreviation

Recombinant Zebrafish dvr1 protein

Gene Name

Dvr1

UniProt

P35621

Expression Region

241-355aa

Organism

Danio rerio (Zebrafish) (Brachydanio rerio)

Target Sequence

SASYYLPVTPSNVCKPRRLYIDFKDVGWQDWIIAPQGYLANYCHGECPFPLSESLNGTNHAILQTLVHSFDPKGTPQPCCVPIKLSPISMLYYDNNDNVVLRHYEDMVVDECGCR

Tag

C-terminal 6xHis-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Others

Relevance

Serves to facilitate the differentiation of either mesoderm or endoderm either as a cofactor in an instructive signal or by providing permissive environment.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

20 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ABR Rabbit Polyclonal Antibody
TA371957 100 µL

ABR Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
5-Bromopentanoic Acid Ethyl Ester
TRC-B686125-1G 1 g

5-Bromopentanoic Acid Ethyl Ester

Sign In for Pricing
View Details
PAX5 / BSAP (Early B-Cell Marker) (PCRP-PAX5-1B1), 1 mg/mL
BNUM1930-50 1x 50 µL

PAX5 / BSAP (Early B-Cell Marker) (PCRP-PAX5-1B1), 1 mg/mL

Sign In for Pricing
View Details
RBFOX1 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI4F9]
TA803488BM 100 µL

RBFOX1 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI4F9]

Sign In for Pricing
View Details
Human PPP2R3C activation kit by CRISPRa
GA110451 1 Kit

Human PPP2R3C activation kit by CRISPRa

Sign In for Pricing
View Details
Tissue FFPE Sections, Seminal vesicle
CS701487 5x 5 µm

Tissue FFPE Sections, Seminal vesicle

Sign In for Pricing
View Details