Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

S100A11, Human

S100A11 Protein facilitates keratinocyte differentiation and cornification, forming homodimers via disulfide linkages. S100A11 Protein, Human is the recombinant human-derived S100A11 protein, expressed by E. coli , with tag free.

Product Specifications

Product Name Alternative

S100A11 Protein, Human, Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/s100a11-protein-human.html

Purity

95.0

Smiles

MAKISSPTETERCIESLIAVFQKYAGKDGYNYTLSKTEFLSFMNTELAAFTKNQKDPGVLDRMMKKLDTNSDGQLDFSEFLNLIGGLAMACHDSFLKAVPSQKRT

Molecular Formula

6282 (Gene_ID) P31949 (M1-T105) (Accession)

Molecular Weight

Approximately 12 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Gpr35 modulator 3
T200983-01 25 mg

Gpr35 modulator 3

Sign In for Pricing
View Details
Gpr35 modulator 3
T200983-02 50 mg

Gpr35 modulator 3

Sign In for Pricing
View Details
Gpr35 modulator 3
T200983-03 100 mg

Gpr35 modulator 3

Sign In for Pricing
View Details
MAL Protein Vector (Mouse) (pPB-N-His)
PV198775 500 ng

MAL Protein Vector (Mouse) (pPB-N-His)

Sign In for Pricing
View Details
Mouse Monoclonal CCR1 Antibody (53504R) [FITC]
FAB145RF 0.1 mL

Mouse Monoclonal CCR1 Antibody (53504R) [FITC]

Sign In for Pricing
View Details
Bovine Integral membrane protein GPR137, GPR137 ELISA KIT
ELI-27181b 96 Tests

Bovine Integral membrane protein GPR137, GPR137 ELISA KIT

Sign In for Pricing
View Details