Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DCBLD1, Human (HEK293, His)

DCBLD1 Protein, Human (HEK293, His) is the recombinant human-derived DCBLD1 protein, expressed by HEK293, with C-His labeled tag.

Product Specifications

Product Name Alternative

DCBLD1 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/dcbld1-protein-human-hek293-his.html

Purity

97.00

Smiles

EELGDGCGHLVTYQDSGTMTSKNYPGTYPNHTVCEKTITVPKGKRLILRLGDLDIESQTCASDYLLFTSSSDQYGPYCGSMTVPKELLLNTSEVTVRFESGSHISGRGFLLTYASSDHPDLITCLERASHYLKTEYSKFCPAGCRDVAGDISGNMVDGYRDTSLLCKAAIHAGIIADELGGQISVLQRKGISRYEGILANGVLSRDGSLSDKRFLFTSNGCSRSLSFEPDGQIRASSSWQSVNESGDQVHWSPGQARLQDQGPSWASGDSSNNHKPREWLEIDLGEKKKITGIRTTGSTQSNFNFYVKSFVMNFKNNNSKWKTYKGIVNNEEKVFQGNSNFRDPVQNNFIPPIVARYVRVVPQTWHQRIALKVELIGCQITQGNDSLVWRKTSQSTSVSTKKEDETITRPIPSEETSTGINITTV

Molecular Formula

285761 (Gene_ID) Q8N8Z6-2 (E35-V459) (Accession)

Molecular Weight

Approximately 55-75 kDa due to the glycosylation

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TNFRSF1A (195-211) Rabbit Polyclonal Antibody
AP23346PU-N 100 µg

TNFRSF1A (195-211) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Human CCL22 Antibody Pair Set
E-KAB-0268 50 µL & 100 µg

Human CCL22 Antibody Pair Set

Sign In for Pricing
View Details
KDM3A / JHDM2A (KDM3A) Human Gene Knockout Kit (CRISPR)
KN215874 1 Kit

KDM3A / JHDM2A (KDM3A) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Tropine-3-thiol Hydrochloride
TRC-T892675-25G 25 g

Tropine-3-thiol Hydrochloride

Sign In for Pricing
View Details
rel-(2S,3aR,7aS)-Octahydroindole-1,2-dicarboxylic Acid t-Butyl Ester
TRC-O236850-1G 1 g

rel-(2S,3aR,7aS)-Octahydroindole-1,2-dicarboxylic Acid t-Butyl Ester

Sign In for Pricing
View Details
PerCP Anti-Mouse CD8a Antibody[YTS 105.18]
AN00331F-01 50 Tests

PerCP Anti-Mouse CD8a Antibody[YTS 105.18]

Sign In for Pricing
View Details