Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Animal-Free IGF-I/IGF-1, Mouse (His)

The IGF-I/IGF-1 protein is structurally similar to insulin and has potent growth-promoting activity. As a physiological regulator, it stimulates glucose transport and glycogen synthesis in osteoblasts, exceeding the efficacy of insulin at lower concentrations. Animal-Free IGF-I/IGF-1 Protein, Mouse (His) is the recombinant mouse-derived animal-FreeIGF-I/IGF-1 protein, expressed by E. coli , with C-His labeled tag.This product is for cell culture use only.

Product Specifications

Product Name Alternative

Animal-Free IGF-I/IGF-1 Protein, Mouse (His), Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/animal-free-igf-i-igf-1-protein-mouse-his.html

Purity

95.00

Smiles

MGPETLCGAELVDALQFVCGPRGFYFNKPTGYGSSIRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPTKAA

Molecular Formula

16000 (Gene_ID) P05017-1 (G49-A118) (Accession)

Molecular Weight

Approximately 11-17 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue Total RNA, Stomach
CR563021 5 µg

Tissue Total RNA, Stomach

Sign In for Pricing
View Details
Hsa-miR-211-5p miRNA Inhibitor
CIH0073-01 10 nmol

Hsa-miR-211-5p miRNA Inhibitor

Sign In for Pricing
View Details
Hsa-miR-211-5p miRNA Inhibitor
CIH0073-02 20 nmol

Hsa-miR-211-5p miRNA Inhibitor

Sign In for Pricing
View Details
Human Glycated High Density Lipoprotein ELISA Kit
GTR10432469 96 Well

Human Glycated High Density Lipoprotein ELISA Kit

Sign In for Pricing
View Details
Mouse Small proline-rich protein 2A (SPRR2A) Elisa Kit
EK731680 96 Well

Mouse Small proline-rich protein 2A (SPRR2A) Elisa Kit

Sign In for Pricing
View Details
Fgd3 (NM_001108409) Rat Tagged ORF Clone Lentiviral Particle
RR207722L3V 200 µL

Fgd3 (NM_001108409) Rat Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details