Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CDO1/Cysteine dioxygenase type 1, Human (His)

Cysteine dioxygenase (CDO1) plays a crucial role in cellular metabolism by catalyzing the oxidation of cysteine to cysteine sulfenic acid, a key step involving the addition of molecular dioxygen . This enzymatic process underlies cysteine catabolism and helps regulate sulfur amino acid metabolism. CDO1/Cysteine dioxygenase type 1 Protein, Human (His) is the recombinant human-derived CDO1/Cysteine dioxygenase type 1 protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

CDO1/Cysteine dioxygenase type 1 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cdo1-cysteine-dioxygenase-type-1-protein-human-his.html

Purity

95.00

Smiles

MEQTEVLKPRTLADLIRILHQLFAGDEVNVEEVQAIMEAYESDPTEWAMYAKFDQYRYTRNLVDQGNGKFNLMILCWGEGHGSSIHDHTNSHCFLKMLQGNLKETLFAWPDKKSNEMVKKSERVLRENQCAYINDSIGLHRVENISHTEPAVSLHLYSPPFDTCHAFDQRTGHKNKVTMTFHSKFGIRTPNATSGSLENN

Molecular Formula

1036 (Gene_ID) Q16878 (M1-N200) (Accession)

Molecular Weight

20-28 kDa

Shipping Conditions

Dry ice.

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

L5178Y TK+/- clone (3.7.2C) Cell Line, BioGenomicsTM discontinued
550959 1x10e6 cells/vial

L5178Y TK+/- clone (3.7.2C) Cell Line, BioGenomicsTM discontinued

Sign In for Pricing
View Details
TRPV5 siRNA (Rat)
MBS8237086-01 15 nmol

TRPV5 siRNA (Rat)

Sign In for Pricing
View Details
TRPV5 siRNA (Rat)
MBS8237086-02 30 nmol

TRPV5 siRNA (Rat)

Sign In for Pricing
View Details
TRPV5 siRNA (Rat)
MBS8237086-03 5x 30 nmol

TRPV5 siRNA (Rat)

Sign In for Pricing
View Details
Beta catenin Mouse mAb, APC conjugated
orb1000491 100 µL

Beta catenin Mouse mAb, APC conjugated

Sign In for Pricing
View Details
Human Retinol Binding Protein 4, Plasma (RBP4) ELISA Kit
abx050197-01 100 µg

Human Retinol Binding Protein 4, Plasma (RBP4) ELISA Kit

Sign In for Pricing
View Details