Recombinant Human Desert hedgehog protein (DHH), partial
Product Specifications
Product Name Alternative
(DHH) (HHG-3)
Abbreviation
Recombinant Human DHH protein, partial
Gene Name
DHH
UniProt
O43323
Expression Region
51-158AA
Organism
Homo sapiens (Human)
Target Sequence
GVPERTLGASGPAEGRVARGSERFRDLVPNYNPDIIFKDEENSGADRLMTERCKERVNALAIAVMNMWPGVRLRVTEGWDEDGHHAQDSLHYEGRALDITTSDRDRNK
Tag
N-terminal 10xHis-GST-tagged and C-terminal Myc-tagged
Type
In Stock Protein
Source
E.coli
Field of Research
Others
Relevance
[Desert hedgehog protein]: The C-terminal part of the desert hedgehog protein precursor displays an autoproteolysis and a cholesterol transferase activity . Both activities result in the cleavage of the full-length protein into two parts (N-product and C-product) followed by the covalent attachment of a cholesterol moiety to the C-terminal of the newly generated N-product . Both activities occur in the reticulum endoplasmic . Functions in cell-cell mediated juxtacrine signaling . Promotes endothelium integrity . Binds to PTCH1 receptor, which functions in association with smoothened (SMO), to activate the transcription of target genes in endothelial cells . In Schwann cells, controls the development of the peripheral nerve sheath and the transition of mesenchymal cells to form the epithelium-like structure of the perineurial tube . [Desert hedgehog protein N-product]: The dually lipidated desert hedgehog protein N-product is essential for a variety of patterning events during development . Binds to the patched (PTCH1) receptor, which functions in association with smoothened (SMO), to activate the transcription of target genes . Required for normal testis development and spermatogenesis, namely for the formation of adult-type Leydig cells and normal development of peritubular cells and seminiferous tubules . Activates primary cilia signaling on neighboring valve interstitial cells through a paracrine mechanism . May induce motor neurons in lateral neural tube and may have a polarizing activity . Prevents the desert hedgehog protein precursor binding to PTCH1 .
Endotoxin
Not test
Purity
Greater than 90% as determined by SDS-PAGE.
Activity
Not Test
Form
Liquid or Lyophilized powder
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Molecular Weight
42.6 kDa
References & Citations
"Full-length Dhh and N-terminal Shh act as competitive antagonists to regulate angiogenesis and vascular permeability." Hollier P.L., Chapouly C., Diop A., Guimbal S., Cornuault L., Gadeau A.P., Renault M.A. Cardiovasc. Res. 117:2489-2501 (2021)
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Protein Length
Partial
Available Sizes
Curated Selection
Explore Other Products
Discover premium biology products from our extensive collection of 20M+ items