Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Desert hedgehog protein (DHH), partial

Product Specifications

Product Name Alternative

(DHH) (HHG-3)

Abbreviation

Recombinant Human DHH protein, partial

Gene Name

DHH

UniProt

O43323

Expression Region

51-158AA

Organism

Homo sapiens (Human)

Target Sequence

GVPERTLGASGPAEGRVARGSERFRDLVPNYNPDIIFKDEENSGADRLMTERCKERVNALAIAVMNMWPGVRLRVTEGWDEDGHHAQDSLHYEGRALDITTSDRDRNK

Tag

N-terminal 10xHis-GST-tagged and C-terminal Myc-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Others

Relevance

[Desert hedgehog protein]: The C-terminal part of the desert hedgehog protein precursor displays an autoproteolysis and a cholesterol transferase activity . Both activities result in the cleavage of the full-length protein into two parts (N-product and C-product) followed by the covalent attachment of a cholesterol moiety to the C-terminal of the newly generated N-product . Both activities occur in the reticulum endoplasmic . Functions in cell-cell mediated juxtacrine signaling . Promotes endothelium integrity . Binds to PTCH1 receptor, which functions in association with smoothened (SMO), to activate the transcription of target genes in endothelial cells . In Schwann cells, controls the development of the peripheral nerve sheath and the transition of mesenchymal cells to form the epithelium-like structure of the perineurial tube . [Desert hedgehog protein N-product]: The dually lipidated desert hedgehog protein N-product is essential for a variety of patterning events during development . Binds to the patched (PTCH1) receptor, which functions in association with smoothened (SMO), to activate the transcription of target genes . Required for normal testis development and spermatogenesis, namely for the formation of adult-type Leydig cells and normal development of peritubular cells and seminiferous tubules . Activates primary cilia signaling on neighboring valve interstitial cells through a paracrine mechanism . May induce motor neurons in lateral neural tube and may have a polarizing activity . Prevents the desert hedgehog protein precursor binding to PTCH1 .

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

42.6 kDa

References & Citations

"Full-length Dhh and N-terminal Shh act as competitive antagonists to regulate angiogenesis and vascular permeability." Hollier P.L., Chapouly C., Diop A., Guimbal S., Cornuault L., Gadeau A.P., Renault M.A. Cardiovasc. Res. 117:2489-2501 (2021)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

BHMT2 (NM_001178005) Human Over-expression Lysate
LC432850 20 µg

BHMT2 (NM_001178005) Human Over-expression Lysate

Sign In for Pricing
View Details
CD23 (Fc Epsilon RII) (FCER2/3592), CF405S conjugate, 0.1mg/mL
BNC043592-500 1x 500 µL

CD23 (Fc Epsilon RII) (FCER2/3592), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Tissue FFPE Sections, Ovary
CS702352 5x 5 µm

Tissue FFPE Sections, Ovary

Sign In for Pricing
View Details
ANKRD53 (NM_001115116) Human Over-expression Lysate
LY426523 100 µg

ANKRD53 (NM_001115116) Human Over-expression Lysate

Sign In for Pricing
View Details
GnRH-Receptor (LHRH Receptor) (GNRHR/768), CF640R conjugate, 0.1mg/mL
BNC400768-100 1x 100 µL

GnRH-Receptor (LHRH Receptor) (GNRHR/768), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CRKL Rabbit Polyclonal Antibody
AP21023PU-N 100 µg

CRKL Rabbit Polyclonal Antibody

Sign In for Pricing
View Details