Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Solute carrier family 22 member 17 (Slc22a17), partial

Product Specifications

Product Name Alternative

24p3 receptor;24p3R; Brain-type organic cation transporter; Lipocalin-2 receptor

Abbreviation

Recombinant Mouse Slc22a17 protein, partial

Gene Name

Slc22a17

UniProt

Q9D9E0

Expression Region

121-183aa

Organism

Mus musculus (Mouse)

Target Sequence

ARWLIVKRQIEEAQSVLRILAERNRPHGQMLGEEAQEALQELENTCPLPATSTFSFASLLNYR

Tag

C-terminal 6xHis-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Others

Relevance

Cell surface receptor for LCN2 (24p3) that plays a key role in iron homeostasis and transport. Able to bind iron-bound LCN2 (holo-24p3), followed by internalization of holo-24p3 and release of iron, thereby increasing intracellular iron concentration and leading to inhibition of apoptosis. Also binds iron-free LCN2 (apo-24p3), followed by internalization of apo-24p3 and its association with an intracellular siderophore, leading to iron chelation and iron transfer to the extracellular medium, thereby reducing intracellular iron concentration and resulting in apoptosis.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

14.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Spectrin beta III Antibody / SPTBN2
V7890SAF-100UG 100 µg

Recombinant Spectrin beta III Antibody / SPTBN2

Sign In for Pricing
View Details
Lentiviral mouse Pcsk4 shRNA (UAS) - Lentiviral mouse Pcsk4 shRNA (UAS, GFP) (100)
GTR15281841 1 Vial

Lentiviral mouse Pcsk4 shRNA (UAS) - Lentiviral mouse Pcsk4 shRNA (UAS, GFP) (100)

Sign In for Pricing
View Details
ER
Mab-607082 0.1ml

ER

Sign In for Pricing
View Details
Monkey SIGLEC8 (Sialic Acid Binding Ig Like Lectin 8) ELISA Kit
MBS2510601-01 24 Tests

Monkey SIGLEC8 (Sialic Acid Binding Ig Like Lectin 8) ELISA Kit

Sign In for Pricing
View Details
Monkey SIGLEC8 (Sialic Acid Binding Ig Like Lectin 8) ELISA Kit
MBS2510601-02 48 Tests

Monkey SIGLEC8 (Sialic Acid Binding Ig Like Lectin 8) ELISA Kit

Sign In for Pricing
View Details
Monkey SIGLEC8 (Sialic Acid Binding Ig Like Lectin 8) ELISA Kit
MBS2510601-03 96 Tests

Monkey SIGLEC8 (Sialic Acid Binding Ig Like Lectin 8) ELISA Kit

Sign In for Pricing
View Details