Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IFN-gamma, Feline

IFN-gamma (Interferon-gamma) is a type II interferon produced by immune cells such as T cells and NK cells, which can significantly activate antibacterial, antiviral and anti-tumor responses. Its main JAK-STAT signaling pathway is triggered by interaction with the receptor IFNGR1, affecting gene regulation. IFN-gamma Protein, Feline is the recombinant IFN-gamma protein, expressed by E. coli , with tag free.

Product Specifications

Product Name Alternative

IFN-gamma Protein, Feline, Others, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ifn-gamma-protein-feline.html

Purity

97.00

Smiles

QAMFFKEIEELKGYFNASNPDVADGGSLFVDILKNWKEESDKTIIQSQIVSFYLKMFENLKDDDQRIQRSMDTIKEDMLDKLLNTSSSKRDDFLKLIQIPVNDLQVQRKAINELFKVMNDLSPRSNLRKRKRSQNLFRGRRASK

Molecular Formula

493965 (Gene_ID) P46402 (Q24-K167) (Accession)

Molecular Weight

Approximately 16 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GPR56 (ADGRG1) Rabbit Polyclonal Antibody
TA368429 100 µL

GPR56 (ADGRG1) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Plastin L (LCP1) Rabbit Polyclonal Antibody
TA369194 100 µL

Plastin L (LCP1) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
NGF-Receptor (p75) / CD271 (Soft Tissue Tumor Marker) (NGFR/1997R), CF740 conjugate, 0.1mg/mL
BNC741997-500 1x 500 µL

NGF-Receptor (p75) / CD271 (Soft Tissue Tumor Marker) (NGFR/1997R), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cntn1 Mouse Monoclonal Antibody [Clone ID: K73/20]
75-038 100 µL

Cntn1 Mouse Monoclonal Antibody [Clone ID: K73/20]

Sign In for Pricing
View Details
Drotebanol
TRC-D689850-25MG 25 mg

Drotebanol

Sign In for Pricing
View Details
Human NAT14 activation kit by CRISPRa
GA111375 1 Kit

Human NAT14 activation kit by CRISPRa

Sign In for Pricing
View Details