Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IFN-gamma, Feline

IFN-gamma (Interferon-gamma) is a type II interferon produced by immune cells such as T cells and NK cells, which can significantly activate antibacterial, antiviral and anti-tumor responses. Its main JAK-STAT signaling pathway is triggered by interaction with the receptor IFNGR1, affecting gene regulation. IFN-gamma Protein, Feline is the recombinant IFN-gamma protein, expressed by E. coli , with tag free.

Product Specifications

Product Name Alternative

IFN-gamma Protein, Feline, Others, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ifn-gamma-protein-feline.html

Purity

97.00

Smiles

QAMFFKEIEELKGYFNASNPDVADGGSLFVDILKNWKEESDKTIIQSQIVSFYLKMFENLKDDDQRIQRSMDTIKEDMLDKLLNTSSSKRDDFLKLIQIPVNDLQVQRKAINELFKVMNDLSPRSNLRKRKRSQNLFRGRRASK

Molecular Formula

493965 (Gene_ID) P46402 (Q24-K167) (Accession)

Molecular Weight

Approximately 16 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PAR2 Recombinant Rabbit Monoclonal Antibody [JE35-05]
HA721426 100 µL

PAR2 Recombinant Rabbit Monoclonal Antibody [JE35-05]

Sign In for Pricing
View Details
Telethonin (TCAP) Mouse Monoclonal Antibody [Clone ID: OTI1A7]
CF808340 100 µg

Telethonin (TCAP) Mouse Monoclonal Antibody [Clone ID: OTI1A7]

Sign In for Pricing
View Details
5-Aminoquinoline
TRC-A629165-1G 1 g

5-Aminoquinoline

Sign In for Pricing
View Details
GUCY2D (NM_000180) Human Over-expression Lysate
LC424878 20 µg

GUCY2D (NM_000180) Human Over-expression Lysate

Sign In for Pricing
View Details
Human DCUN1D3 activation kit by CRISPRa
GA114822 1 Kit

Human DCUN1D3 activation kit by CRISPRa

Sign In for Pricing
View Details
H2BC13 (NM_003519) Human Recombinant Protein
TP310827L 1 mg

H2BC13 (NM_003519) Human Recombinant Protein

Sign In for Pricing
View Details