Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IFN-gamma, Feline

IFN-gamma (Interferon-gamma) is a type II interferon produced by immune cells such as T cells and NK cells, which can significantly activate antibacterial, antiviral and anti-tumor responses. Its main JAK-STAT signaling pathway is triggered by interaction with the receptor IFNGR1, affecting gene regulation. IFN-gamma Protein, Feline is the recombinant IFN-gamma protein, expressed by E. coli , with tag free.

Product Specifications

Product Name Alternative

IFN-gamma Protein, Feline, Others, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ifn-gamma-protein-feline.html

Purity

97.00

Smiles

QAMFFKEIEELKGYFNASNPDVADGGSLFVDILKNWKEESDKTIIQSQIVSFYLKMFENLKDDDQRIQRSMDTIKEDMLDKLLNTSSSKRDDFLKLIQIPVNDLQVQRKAINELFKVMNDLSPRSNLRKRKRSQNLFRGRRASK

Molecular Formula

493965 (Gene_ID) P46402 (Q24-K167) (Accession)

Molecular Weight

Approximately 16 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse Dgat1 shRNA (UAS) - Lentiviral mouse Dgat1 shRNA (UAS, GFP) (100)
GTR15303132 1 Vial

Lentiviral mouse Dgat1 shRNA (UAS) - Lentiviral mouse Dgat1 shRNA (UAS, GFP) (100)

Sign In for Pricing
View Details
SCFD1 Antibody (C-term)
orb36854-01 50 µL

SCFD1 Antibody (C-term)

Sign In for Pricing
View Details
SCFD1 Antibody (C-term)
orb36854-02 100 µL

SCFD1 Antibody (C-term)

Sign In for Pricing
View Details
JUND Human Gene Knockout Kit (CRISPR)
KN416958 1 Kit

JUND Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Eef2k Mouse shRNA Lentiviral Particle (Locus ID 13631)
TL512764V 500 µL Each

Eef2k Mouse shRNA Lentiviral Particle (Locus ID 13631)

Sign In for Pricing
View Details
Human beta Defensin 1/DEFB1 HEK293 Overexpression Lysate
MBS8115457-01 0.3 mg

Human beta Defensin 1/DEFB1 HEK293 Overexpression Lysate

Sign In for Pricing
View Details