Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MCP-1/CCL2, Mouse

MCP-1/CCL2 Protein, Mouse is a cytokine belonging to the CC chemokine family that interacts with the CCR2 chemokine receptor on the cell surface to mediate inflammatory immune responses, viral infections, and tumorigenesis. MCP-1/CCL2 Protein, Mouse is a mouse MCP-1/CCL2 (Q24-R96) expressed by E.coil[1].

Product Specifications

Product Name Alternative

MCP-1/CCL2 Protein, Mouse, Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/mcp-1-ccl2-protein-mouse.html

Purity

98.0

Smiles

QPDAVNAPLTCCYSFTSKMIPMSRLESYKRITSSRCPKEAVVFVTKLKREVCADPKKEWVQTYIKNLDRNQMR

Molecular Formula

20296 (Gene_ID) P10148 (Q24-R96) (Accession)

Molecular Weight

Approximately 9-12 kDa, based on SDS-PAGE under reducing conditions.

References & Citations

[1]Martha Gschwandtner, et al. More Than Just Attractive: How CCL2 Influences Myeloid Cell Behavior Beyond Chemotaxis. Front Immunol. 2019 Dec 13;10:2759.|[2]Qiongyu Hao, et al. CCL2/CCR2 signaling in cancer pathogenesis. Cell Commun Signal. 2020 May 29;18 (1) :82.|[3]Svetlana M Stamatovic, et al. Monocyte chemoattractant protein-1 regulation of blood-brain barrier permeability. J Cereb Blood Flow Metab. 2005 May;25 (5) :593-606.|[4]Rachel N Gomes, et al. Bacterial clearance in septic mice is modulated by MCP-1/CCL2 and nitric oxide. Shock. 2013 Jan;39 (1) :63-9.|[5]Lijun Zhang, et al. Effect of chemokine CC ligand 2 (CCL2) on α?synuclein?induced microglia proliferation and neuronal apoptosis. Mol Med Rep. 2018 Nov;18 (5) :4213-4218.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Herpes Simplex Virus Type 2 (HSV-2) Antibody
orb23094 1 mL

Herpes Simplex Virus Type 2 (HSV-2) Antibody

Sign In for Pricing
View Details
Kif18a 3'UTR GFP Stable Cell Line
TU160549 1.0 mL

Kif18a 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Rabbit Polyclonal C4orf3 Antibody
NBP2-82915-0.1mL 0.1 mL

Rabbit Polyclonal C4orf3 Antibody

Sign In for Pricing
View Details
4-Phenylthiophene-3-carboxylic acid
YAA06242-01 50 mg

4-Phenylthiophene-3-carboxylic acid

Sign In for Pricing
View Details
4-Phenylthiophene-3-carboxylic acid
YAA06242-02 0.5 g

4-Phenylthiophene-3-carboxylic acid

Sign In for Pricing
View Details
CD74 Human Monoclonal Antibody
orb2975011-01 50 µg

CD74 Human Monoclonal Antibody

Sign In for Pricing
View Details