Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Leukocyte surface antigen CD47 (CD47), partial (Active)

Product Specifications

Product Name Alternative

Antigenic surface determinant protein OA3 (Integrin-associated protein) (IAP) (Protein MER6) (CD47)

Abbreviation

Recombinant Human CD47 protein, partial (Active)

Gene Name

CD47

UniProt

Q08722

Expression Region

19-139aa

Organism

Homo sapiens (Human)

Target Sequence

QLLFNKTKSVEFTFCNDTVVIPCFVTNMEAQNTTEVYVKWKFKGRDIYTFDGALNKSTVPTDFSSAKIEVSQLLKGDASLKMDKSDAVSHTGNYTCEVTELTREGETIIELKYRVVSWFSP

Tag

C-terminal 10xHis-tagged

Type

Active Protein & In Stock Protein

Source

Mammalian cell

Field of Research

Immunology

Relevance

Has a role in both cell adhesion by acting as an adhesion receptor for THBS1 on platelets, and in the modulation of integrins.

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

Greater than 95% as determined by SDS-PAGE.

Activity

Yes

Bioactivity

①Measured by its binding ability in a functional ELISA. Immobilized Human CD47 (CSB-MP004940HUd7) at 2 μg/mL can bind Human SIRPA protein. The EC50 is 98.73-112.7 ng/mL. ②Measured by its binding ability in a functional ELISA. Immobilized Human CD47 at 2 μg/mL can bind Anti-CD47 recombinant antibody (CSB-RA004940MA1HU) . The EC50 is 1.343-1.561 ng/mL.

Form

Lyophilized powder

Buffer

Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

15.1 kDa

References & Citations

"An ovarian tumor marker with homology to vaccinia virus contains an IgV-like region and multiple transmembrane domains." Campbell I.G., Freemont P.S., Foulkes W., Trowsdale J. Cancer Res. 52:5416-5420 (1992)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Glycine dehydrogenase antibody
70R-13355 100 µL

Glycine dehydrogenase antibody

Sign In for Pricing
View Details
Histone H3.1 (HIST1H3J, Histone H3K27me2, H3/j, H3FJ, Histone H3/a, Histone H3/b,Histone H3/c, Histone H3/d, Histone H3/f,Histone H3/h, Histone H3/I,Histone H3/j, _+E_Histone H3/k, Histone H3/l, HIST3H3) (MaxLight 405)
MBS6420561-01 0.1 mL

Histone H3.1 (HIST1H3J, Histone H3K27me2, H3/j, H3FJ, Histone H3/a, Histone H3/b,Histone H3/c, Histone H3/d, Histone H3/f,Histone H3/h, Histone H3/I,Histone H3/j, _+E_Histone H3/k, Histone H3/l, HIST3H3) (MaxLight 405)

Sign In for Pricing
View Details
Histone H3.1 (HIST1H3J, Histone H3K27me2, H3/j, H3FJ, Histone H3/a, Histone H3/b,Histone H3/c, Histone H3/d, Histone H3/f,Histone H3/h, Histone H3/I,Histone H3/j, _+E_Histone H3/k, Histone H3/l, HIST3H3) (MaxLight 405)
MBS6420561-02 5x 0.1 mL

Histone H3.1 (HIST1H3J, Histone H3K27me2, H3/j, H3FJ, Histone H3/a, Histone H3/b,Histone H3/c, Histone H3/d, Histone H3/f,Histone H3/h, Histone H3/I,Histone H3/j, _+E_Histone H3/k, Histone H3/l, HIST3H3) (MaxLight 405)

Sign In for Pricing
View Details
Proteinase 3, Human, mAb WGM2 Antibody
orb1108908 100 µg

Proteinase 3, Human, mAb WGM2 Antibody

Sign In for Pricing
View Details
NCOA3 Rabbit Polyclonal Antibody (APC-Cy7)
orb2433994 100 µL

NCOA3 Rabbit Polyclonal Antibody (APC-Cy7)

Sign In for Pricing
View Details
Recombinant Human RNF125 protein, His-tagged
RNF125-2646H 25 µg

Recombinant Human RNF125 protein, His-tagged

Sign In for Pricing
View Details