Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD3 zeta/CD247, Human (His)

CD3 zeta/CD247 is a component of the TCR-CD3 complex and can transmit APC-induced TCR signals to initiate immune responses. CD3D, CD3E, CD3G, and CD3Z contain ITAMs that are phosphorylated by LCK and FYN upon TCR engagement, providing docking sites for ZAP70. CD3 zeta/CD247 Protein, Human (GST) is the recombinant human-derived CD3 zeta/CD247 protein, expressed by E. coli , with N-GST labeled tag.

Product Specifications

Product Name Alternative

CD3 zeta/CD247 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd3-zeta-cd247-protein-human-gst.html

Purity

97.00

Smiles

RVKFSRSADAPAYQQGQNQLYNELNLGRREEYDVLDKRRGRDPEMGGKPQRRKNPQEGLYNELQKDKMAEAYSEIGMKGERRRGKGHDGLYQGLSTATKDTYDALHMQALPPR

Molecular Formula

919 (Gene_ID) P20963-1 (R52-R164) (Accession)

Molecular Weight

Approximately 16 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human cyclin D3/CCND3 protein (His tag)
PDEH100920-01 20 µg

Recombinant Human cyclin D3/CCND3 protein (His tag)

Sign In for Pricing
View Details
Recombinant Human cyclin D3/CCND3 protein (His tag)
PDEH100920-02 100 µg

Recombinant Human cyclin D3/CCND3 protein (His tag)

Sign In for Pricing
View Details
Recombinant Human cyclin D3/CCND3 protein (His tag)
PDEH100920-03 500 µg

Recombinant Human cyclin D3/CCND3 protein (His tag)

Sign In for Pricing
View Details
Recombinant Human cyclin D3/CCND3 protein (His tag)
PDEH100920-04 1 mg

Recombinant Human cyclin D3/CCND3 protein (His tag)

Sign In for Pricing
View Details
PSMB3 (NM_002795) Human Over-expression Lysate
LC419105 20 µg

PSMB3 (NM_002795) Human Over-expression Lysate

Sign In for Pricing
View Details
Human PRAMEF4 activation kit by CRISPRa
GA118282 1 Kit

Human PRAMEF4 activation kit by CRISPRa

Sign In for Pricing
View Details