Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD3 zeta/CD247, Human (His)

CD3 zeta/CD247 is a component of the TCR-CD3 complex and can transmit APC-induced TCR signals to initiate immune responses. CD3D, CD3E, CD3G, and CD3Z contain ITAMs that are phosphorylated by LCK and FYN upon TCR engagement, providing docking sites for ZAP70. CD3 zeta/CD247 Protein, Human (GST) is the recombinant human-derived CD3 zeta/CD247 protein, expressed by E. coli , with N-GST labeled tag.

Product Specifications

Product Name Alternative

CD3 zeta/CD247 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd3-zeta-cd247-protein-human-gst.html

Purity

97.00

Smiles

RVKFSRSADAPAYQQGQNQLYNELNLGRREEYDVLDKRRGRDPEMGGKPQRRKNPQEGLYNELQKDKMAEAYSEIGMKGERRRGKGHDGLYQGLSTATKDTYDALHMQALPPR

Molecular Formula

919 (Gene_ID) P20963-1 (R52-R164) (Accession)

Molecular Weight

Approximately 16 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Dehydro Cyclosporin A (~90%)
TRC-D230190-5MG 5 mg

Dehydro Cyclosporin A (~90%)

Sign In for Pricing
View Details
MSH2 (DNA Mismatch Repair Marker) (MSH2/2622), CF488A conjugate, 0.1mg/mL
BNC882622-100 1x 100 µL

MSH2 (DNA Mismatch Repair Marker) (MSH2/2622), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
LSS Rabbit Polyclonal Antibody
HA500011 100 µL

LSS Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Cyclin T2 (CCNT2) (NM_001241) Human Over-expression Lysate
LC420056 20 µg

Cyclin T2 (CCNT2) (NM_001241) Human Over-expression Lysate

Sign In for Pricing
View Details
TLE1 (Synovial Sarcoma Marker) (TLE1/2085), 0.2mg/mL
BNUB2085-500 1x 500 µL

TLE1 (Synovial Sarcoma Marker) (TLE1/2085), 0.2mg/mL

Sign In for Pricing
View Details
Clathrin light chain (CLTB) (NM_007097) Human Recombinant Protein
TP324622 20 µg

Clathrin light chain (CLTB) (NM_007097) Human Recombinant Protein

Sign In for Pricing
View Details