Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD3 zeta/CD247, Human (His)

CD3 zeta/CD247 is a component of the TCR-CD3 complex and can transmit APC-induced TCR signals to initiate immune responses. CD3D, CD3E, CD3G, and CD3Z contain ITAMs that are phosphorylated by LCK and FYN upon TCR engagement, providing docking sites for ZAP70. CD3 zeta/CD247 Protein, Human (GST) is the recombinant human-derived CD3 zeta/CD247 protein, expressed by E. coli , with N-GST labeled tag.

Product Specifications

Product Name Alternative

CD3 zeta/CD247 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd3-zeta-cd247-protein-human-gst.html

Purity

97.00

Smiles

RVKFSRSADAPAYQQGQNQLYNELNLGRREEYDVLDKRRGRDPEMGGKPQRRKNPQEGLYNELQKDKMAEAYSEIGMKGERRRGKGHDGLYQGLSTATKDTYDALHMQALPPR

Molecular Formula

919 (Gene_ID) P20963-1 (R52-R164) (Accession)

Molecular Weight

Approximately 16 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Power Station Power Source
43133005-1 1 Each

Power Station Power Source

Sign In for Pricing
View Details
3,4-Bis (trifluoromethyl) pyrrolidine hydrochloride
EEC95961-01 50 mg

3,4-Bis (trifluoromethyl) pyrrolidine hydrochloride

Sign In for Pricing
View Details
3,4-Bis (trifluoromethyl) pyrrolidine hydrochloride
EEC95961-02 0.5 g

3,4-Bis (trifluoromethyl) pyrrolidine hydrochloride

Sign In for Pricing
View Details
PKC theta Rabbit Polyclonal Antibody (RBITC)
orb1044247 100 µL

PKC theta Rabbit Polyclonal Antibody (RBITC)

Sign In for Pricing
View Details
APC/CY7-Linked Polyclonal Antibody to C-Type Lectin Domain Family 4, Member L (CLEC4L)
MBS2057123-01 0.1 mL

APC/CY7-Linked Polyclonal Antibody to C-Type Lectin Domain Family 4, Member L (CLEC4L)

Sign In for Pricing
View Details
APC/CY7-Linked Polyclonal Antibody to C-Type Lectin Domain Family 4, Member L (CLEC4L)
MBS2057123-02 0.2 mL

APC/CY7-Linked Polyclonal Antibody to C-Type Lectin Domain Family 4, Member L (CLEC4L)

Sign In for Pricing
View Details