Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TNFRSF12A, Mouse (HEK293, Fc)

TNFRSF12A Protein, a receptor for TNFSF12/TWEAK, exhibits a weak apoptosis-inducing ability in specific cells.It promotes angiogenesis and endothelial cell proliferation, and may modulate cellular adhesion to matrix proteins.In functional interactions, TNFRSF12A associates with TRAF1 and TRAF2, possibly with TRAF3, suggesting its involvement in signaling pathways contributing to diverse cellular processes.TNFRSF12A Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived TNFRSF12A protein, expressed by HEK293 , with C-hFc labeled tag.

Product Specifications

Product Name Alternative

TNFRSF12A Protein, Mouse (HEK293, Fc), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/tnfrsf12a-protein-mouse-hek-293-fc.html

Purity

98.0

Smiles

EQAPGTAPCSRGSSWSADLDKCMDCASCRARPHSDFCLGCAAAPPAPFRLLW

Molecular Formula

27279 (Gene_ID) Q9CR75 (E28-W79) (Accession)

Molecular Weight

30-40 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD59 (heavy chain of Protectin) (BRA-10G), CF405S conjugate, 0.1mg/mL
BNC040181-500 1x 500 µL

CD59 (heavy chain of Protectin) (BRA-10G), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD100 (Semaphorin-4D) (A8), CF640R conjugate, 0.1mg/mL
BNC400218-500 1x 500 µL

CD100 (Semaphorin-4D) (A8), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD11a (Cris-3), CF740 conjugate, 0.1mg/mL
BNC740151-500 1x 500 µL

CD11a (Cris-3), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MUC2 (CCP58), CF594 conjugate, 0.1mg/mL
BNC940032-100 1x 100 µL

MUC2 (CCP58), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD3e (Rabbit PAb), CF568 conjugate, 0.1mg/mL
BNC680385-100 1x 100 µL

CD3e (Rabbit PAb), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Arginase 1 (Hepatocellular Carcinoma Marker) (ARG1/1126), CF568 conjugate, 0.1mg/mL
BNC681126-100 1x 100 µL

Arginase 1 (Hepatocellular Carcinoma Marker) (ARG1/1126), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details