Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CDTB, E.coli (Myc, His-SUMO)

CDTB Protein, integral to the tripartite complex for Cytolethal Distending Toxin (CDT) activity, features DNA-nicking endonuclease action, likely causing DNA damage. This damage prompts G2/M cell cycle arrest, chromatin fragmentation, cell distention, and nucleus enlargement. Collaborating with CdtA and CdtC, CDTB forms a crucial unit for CDT's cytotoxic effects, showcasing its multifaceted role in cellular responses to CDT intoxication. CDTB Protein, E.coli (Myc, His-SUMO) is the recombinant E. coli-derived CDTB protein, expressed by E. coli , with N-His, C-Myc, N-SUMO labeled tag.

Product Specifications

Product Name Alternative

CDTB Protein, E.coli (Myc, His-SUMO), E.coli, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cdt-b-protein-e-coli-myc-his-sumo.html

Smiles

DLTDFRVATWNLQGASATTESKWNINVRQLISGENAVDILAVQEAGSPPSTAVDTGTLIPSPGIPVRELIWNLSTNSRPQQVYIYFSAVDALGGRVNLALVSNRRADEVFVLSPVRQGGRPLLGIRIGNDAFFTAHAIAMRNNDAPALVEEVYNFFRDSRDPVHQALNWMILGDFNREPADLEMNLTVPVRRASEIISPAAATQTSQRTLDYAVAGNSVAFRPSPLQAGIVYGARRTQISSDHFPVGVSRR

Molecular Formula

/ (Gene_ID) Q46669 (D19-R269) (Accession)

Molecular Weight

Approximately 47.4 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

HIST1H2AC (H2AC6) (NM_003512) Human Tagged ORF Clone Lentiviral Particle
RC210259L2V 200 µL

HIST1H2AC (H2AC6) (NM_003512) Human Tagged ORF Clone Lentiviral Particle

Ask
View Details
1-[3-[ (4-Bromophenyl) sulfonyl]-2-quinoxalinyl]-4-piperidinol
158352 10 mg

1-[3-[ (4-Bromophenyl) sulfonyl]-2-quinoxalinyl]-4-piperidinol

Ask
View Details
MICAL3 (NM_001122731) Human Tagged Lenti ORF Clone
RC226281L3 10 µg

MICAL3 (NM_001122731) Human Tagged Lenti ORF Clone

Ask
View Details
NEDD8 antibody
70R-50112 100 ul

NEDD8 antibody

Ask
View Details