Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Animal-Free BMP-10, Human (His)

BMP-10 is essential for embryonic cardiomyocyte proliferation, preventing premature activation of CDKN1C/p57KIP and ensuring optimal expression of MEF2C and NKX2-5.As a ligand for AVRL1/ALK1, BMPR1A/ALK3 and BMPR1B/ALK6, it activates SMAD1, SMAD5 and SMAD8, regulating key signaling pathways.Animal-Free BMP-10 Protein, Human (His) is the recombinant human-derived animal-FreeBMP-10 protein, expressed by E.coli , with C-His labeled tag.This product is for cell culture use only.

Product Specifications

Product Name Alternative

Animal-Free BMP-10 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/animal-free-bmp-10-protein-human-his.html

Purity

98.0

Smiles

MNAKGNYCKRTPLYIDFKEIGWDSWIIAPPGYEAYECRGVCNYPLAEHLTPTKHAIIQALVHLKNSQKASKACCVPTKLEPISILYLDKGVVTYKFKYEGMAVSECGCR

Molecular Formula

27302 (Gene_ID) O95393 (N317-R424) (Accession)

Molecular Weight

Approximately 16 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human ZNF814 Protein
E30P9536 20 µg

Recombinant Human ZNF814 Protein

Sign In for Pricing
View Details
Sh3glb1 ORF Vector (Mouse) (pORF)
ORF057219 1.0 µg DNA

Sh3glb1 ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details
Fam227a (NM_029407) Mouse Tagged ORF Clone
MG214158 10 µg

Fam227a (NM_029407) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
BMP11 (Growth/Differentiation Factor 11, GDF-11, Bone Morphogenetic Protein 11, BMP-11, GDF11) (APC)
127251-APC 100 µL

BMP11 (Growth/Differentiation Factor 11, GDF-11, Bone Morphogenetic Protein 11, BMP-11, GDF11) (APC)

Sign In for Pricing
View Details
Recombinant Human Discoidin Domain Receptor Family, Member 1 (DDR1)
RPU59748-01 50 µg

Recombinant Human Discoidin Domain Receptor Family, Member 1 (DDR1)

Sign In for Pricing
View Details
Recombinant Human Discoidin Domain Receptor Family, Member 1 (DDR1)
RPU59748-02 100 µg

Recombinant Human Discoidin Domain Receptor Family, Member 1 (DDR1)

Sign In for Pricing
View Details