Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Animal-Free BMP-10, Human (His)

BMP-10 is essential for embryonic cardiomyocyte proliferation, preventing premature activation of CDKN1C/p57KIP and ensuring optimal expression of MEF2C and NKX2-5.As a ligand for AVRL1/ALK1, BMPR1A/ALK3 and BMPR1B/ALK6, it activates SMAD1, SMAD5 and SMAD8, regulating key signaling pathways.Animal-Free BMP-10 Protein, Human (His) is the recombinant human-derived animal-FreeBMP-10 protein, expressed by E.coli , with C-His labeled tag.This product is for cell culture use only.

Product Specifications

Product Name Alternative

Animal-Free BMP-10 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/animal-free-bmp-10-protein-human-his.html

Purity

98.0

Smiles

MNAKGNYCKRTPLYIDFKEIGWDSWIIAPPGYEAYECRGVCNYPLAEHLTPTKHAIIQALVHLKNSQKASKACCVPTKLEPISILYLDKGVVTYKFKYEGMAVSECGCR

Molecular Formula

27302 (Gene_ID) O95393 (N317-R424) (Accession)

Molecular Weight

Approximately 16 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Complement Factor I (C3B/C4B Inactivator, CFI, IF) (MaxLight 650)
MBS6374409-01 0.1 mL

Complement Factor I (C3B/C4B Inactivator, CFI, IF) (MaxLight 650)

Sign In for Pricing
View Details
Complement Factor I (C3B/C4B Inactivator, CFI, IF) (MaxLight 650)
MBS6374409-02 5x 0.1 mL

Complement Factor I (C3B/C4B Inactivator, CFI, IF) (MaxLight 650)

Sign In for Pricing
View Details
Lcat Rat siRNA Oligo Duplex (Locus ID 24530)
SR507118 1 Kit

Lcat Rat siRNA Oligo Duplex (Locus ID 24530)

Sign In for Pricing
View Details
Vmp1 sgRNA CRISPR Lentivector set (Mouse)
K4517901 3x 1.0 µg

Vmp1 sgRNA CRISPR Lentivector set (Mouse)

Sign In for Pricing
View Details
Hepatitis C Virus (HCV) [MCA (7-Methoxycoumarin Acetic Acid) -Glu-Asp-Ala-Ser-Thr-Pro-Cys]
H1924-81F 1 mg

Hepatitis C Virus (HCV) [MCA (7-Methoxycoumarin Acetic Acid) -Glu-Asp-Ala-Ser-Thr-Pro-Cys]

Sign In for Pricing
View Details
Erythrosin B 0.1% Solution
RRSP5694-E 1 L

Erythrosin B 0.1% Solution

Sign In for Pricing
View Details