Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Animal-Free BMP-10, Human (His)

BMP-10 is essential for embryonic cardiomyocyte proliferation, preventing premature activation of CDKN1C/p57KIP and ensuring optimal expression of MEF2C and NKX2-5.As a ligand for AVRL1/ALK1, BMPR1A/ALK3 and BMPR1B/ALK6, it activates SMAD1, SMAD5 and SMAD8, regulating key signaling pathways.Animal-Free BMP-10 Protein, Human (His) is the recombinant human-derived animal-FreeBMP-10 protein, expressed by E.coli , with C-His labeled tag.This product is for cell culture use only.

Product Specifications

Product Name Alternative

Animal-Free BMP-10 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/animal-free-bmp-10-protein-human-his.html

Purity

98.0

Smiles

MNAKGNYCKRTPLYIDFKEIGWDSWIIAPPGYEAYECRGVCNYPLAEHLTPTKHAIIQALVHLKNSQKASKACCVPTKLEPISILYLDKGVVTYKFKYEGMAVSECGCR

Molecular Formula

27302 (Gene_ID) O95393 (N317-R424) (Accession)

Molecular Weight

Approximately 16 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

T220-6005, T-connector, with 200 series barb, for I-Ø 2.4 mm, PP sales unit 1000 pieces
1211539 1 PC

T220-6005, T-connector, with 200 series barb, for I-Ø 2.4 mm, PP sales unit 1000 pieces

Sign In for Pricing
View Details
Human GAGE12D knockdown cell line
ABC-KD5855 1 Vial

Human GAGE12D knockdown cell line

Sign In for Pricing
View Details
C19orf43 sgRNA CRISPR Lentivector (Human) (Target 2)
K0328903 1.0 µg DNA

C19orf43 sgRNA CRISPR Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
KPNB1 Antibody, FITC conjugated
A55718-100UL 100 µL

KPNB1 Antibody, FITC conjugated

Sign In for Pricing
View Details
Human BDNF MAb (Clone 35928)
MAB248-SP 25 µg

Human BDNF MAb (Clone 35928)

Sign In for Pricing
View Details
EIF2D Blocking Peptide
MBS9621124-01 1 mg

EIF2D Blocking Peptide

Sign In for Pricing
View Details