Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Animal-Free BMP-10, Human (His)

BMP-10 is essential for embryonic cardiomyocyte proliferation, preventing premature activation of CDKN1C/p57KIP and ensuring optimal expression of MEF2C and NKX2-5.As a ligand for AVRL1/ALK1, BMPR1A/ALK3 and BMPR1B/ALK6, it activates SMAD1, SMAD5 and SMAD8, regulating key signaling pathways.Animal-Free BMP-10 Protein, Human (His) is the recombinant human-derived animal-FreeBMP-10 protein, expressed by E.coli , with C-His labeled tag.This product is for cell culture use only.

Product Specifications

Product Name Alternative

Animal-Free BMP-10 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/animal-free-bmp-10-protein-human-his.html

Purity

98.0

Smiles

MNAKGNYCKRTPLYIDFKEIGWDSWIIAPPGYEAYECRGVCNYPLAEHLTPTKHAIIQALVHLKNSQKASKACCVPTKLEPISILYLDKGVVTYKFKYEGMAVSECGCR

Molecular Formula

27302 (Gene_ID) O95393 (N317-R424) (Accession)

Molecular Weight

Approximately 16 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal MCM6 Antibody (MCM6/2999) [DyLight 680]
NBP2-79862FR 0.1 mL

Mouse Monoclonal MCM6 Antibody (MCM6/2999) [DyLight 680]

Sign In for Pricing
View Details
Sptan1 (NM_001076554) Mouse Tagged ORF Clone
MG222892 10 µg

Sptan1 (NM_001076554) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
CD14 Rabbit pAb
E47R20796 100 µL

CD14 Rabbit pAb

Sign In for Pricing
View Details
LRRC73 Protein Vector (Rat) (pPB-N-His)
PV280143 500 ng

LRRC73 Protein Vector (Rat) (pPB-N-His)

Sign In for Pricing
View Details
NR1D2
MBS8563722-01 0.2 mL

NR1D2

Sign In for Pricing
View Details
NR1D2
MBS8563722-02 0.1 mL (AF405L)

NR1D2

Sign In for Pricing
View Details