Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Animal-Free BMP-10, Human (His)

BMP-10 is essential for embryonic cardiomyocyte proliferation, preventing premature activation of CDKN1C/p57KIP and ensuring optimal expression of MEF2C and NKX2-5.As a ligand for AVRL1/ALK1, BMPR1A/ALK3 and BMPR1B/ALK6, it activates SMAD1, SMAD5 and SMAD8, regulating key signaling pathways.Animal-Free BMP-10 Protein, Human (His) is the recombinant human-derived animal-FreeBMP-10 protein, expressed by E.coli , with C-His labeled tag.This product is for cell culture use only.

Product Specifications

Product Name Alternative

Animal-Free BMP-10 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/animal-free-bmp-10-protein-human-his.html

Purity

98.0

Smiles

MNAKGNYCKRTPLYIDFKEIGWDSWIIAPPGYEAYECRGVCNYPLAEHLTPTKHAIIQALVHLKNSQKASKACCVPTKLEPISILYLDKGVVTYKFKYEGMAVSECGCR

Molecular Formula

27302 (Gene_ID) O95393 (N317-R424) (Accession)

Molecular Weight

Approximately 16 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ephrin Type A Receptor 3 (EPHA3) Guinea Pig ELISA Kit
D1987 96 Tests

Ephrin Type A Receptor 3 (EPHA3) Guinea Pig ELISA Kit

Sign In for Pricing
View Details
Mouse Lix1 Pre-designed siRNA Set A
SI107593A 1 Each

Mouse Lix1 Pre-designed siRNA Set A

Sign In for Pricing
View Details
Gm221 Protein Vector (Mouse) (pPM-C-His)
PV183713 500 ng

Gm221 Protein Vector (Mouse) (pPM-C-His)

Sign In for Pricing
View Details
Phospho-LSP1 (Ser252) Polyclonal Antibody, AbBy Fluor™ 555 Conjugated
bs-5156R-BF555 100 µL

Phospho-LSP1 (Ser252) Polyclonal Antibody, AbBy Fluor™ 555 Conjugated

Sign In for Pricing
View Details
Adipor1 Mouse qPCR Primer Pair (NM_028320)
MP200407 200 Reactions

Adipor1 Mouse qPCR Primer Pair (NM_028320)

Sign In for Pricing
View Details
RN5S185 Lentiviral Vector (Human) (EF1a) (pLenti-GIII-EF1a)
LV743896 1.0 µg DNA

RN5S185 Lentiviral Vector (Human) (EF1a) (pLenti-GIII-EF1a)

Sign In for Pricing
View Details