Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Animal-Free BMP-10, Human (His)

BMP-10 is essential for embryonic cardiomyocyte proliferation, preventing premature activation of CDKN1C/p57KIP and ensuring optimal expression of MEF2C and NKX2-5.As a ligand for AVRL1/ALK1, BMPR1A/ALK3 and BMPR1B/ALK6, it activates SMAD1, SMAD5 and SMAD8, regulating key signaling pathways.Animal-Free BMP-10 Protein, Human (His) is the recombinant human-derived animal-FreeBMP-10 protein, expressed by E.coli , with C-His labeled tag.This product is for cell culture use only.

Product Specifications

Product Name Alternative

Animal-Free BMP-10 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/animal-free-bmp-10-protein-human-his.html

Purity

98.0

Smiles

MNAKGNYCKRTPLYIDFKEIGWDSWIIAPPGYEAYECRGVCNYPLAEHLTPTKHAIIQALVHLKNSQKASKACCVPTKLEPISILYLDKGVVTYKFKYEGMAVSECGCR

Molecular Formula

27302 (Gene_ID) O95393 (N317-R424) (Accession)

Molecular Weight

Approximately 16 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

KLF5 Antibody
MBS7050063-01 0.05 mg

KLF5 Antibody

Sign In for Pricing
View Details
KLF5 Antibody
MBS7050063-02 0.1 mg

KLF5 Antibody

Sign In for Pricing
View Details
KLF5 Antibody
MBS7050063-03 5x 0.1 mg

KLF5 Antibody

Sign In for Pricing
View Details
Recombinant Mouse TTC21B Protein, His (Fc)-Avi-tagged
TTC21B-9713M 50 µg

Recombinant Mouse TTC21B Protein, His (Fc)-Avi-tagged

Sign In for Pricing
View Details
Rpia Mouse siRNA Oligo Duplex (Locus ID 19895)
SR406545 1 Kit

Rpia Mouse siRNA Oligo Duplex (Locus ID 19895)

Sign In for Pricing
View Details
Rat Xkr4 Pre-designed siRNA Set A
SI216052A 1 Each

Rat Xkr4 Pre-designed siRNA Set A

Sign In for Pricing
View Details