Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Animal-Free BMP-10, Human (His)

BMP-10 is essential for embryonic cardiomyocyte proliferation, preventing premature activation of CDKN1C/p57KIP and ensuring optimal expression of MEF2C and NKX2-5.As a ligand for AVRL1/ALK1, BMPR1A/ALK3 and BMPR1B/ALK6, it activates SMAD1, SMAD5 and SMAD8, regulating key signaling pathways.Animal-Free BMP-10 Protein, Human (His) is the recombinant human-derived animal-FreeBMP-10 protein, expressed by E.coli , with C-His labeled tag.This product is for cell culture use only.

Product Specifications

Product Name Alternative

Animal-Free BMP-10 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/animal-free-bmp-10-protein-human-his.html

Purity

98.0

Smiles

MNAKGNYCKRTPLYIDFKEIGWDSWIIAPPGYEAYECRGVCNYPLAEHLTPTKHAIIQALVHLKNSQKASKACCVPTKLEPISILYLDKGVVTYKFKYEGMAVSECGCR

Molecular Formula

27302 (Gene_ID) O95393 (N317-R424) (Accession)

Molecular Weight

Approximately 16 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ccdc25 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 1)
K4120406 1.0 µg DNA

Ccdc25 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 1)

Sign In for Pricing
View Details
DIS3 Antibody, Biotin conjugated
A72569-100UG 100 µg

DIS3 Antibody, Biotin conjugated

Sign In for Pricing
View Details
Human TTLL8 Knockout A549 cell line
GTR15416676 1 Vial

Human TTLL8 Knockout A549 cell line

Sign In for Pricing
View Details
T-box Brain Protein 1 (TBR1, T-box Brain 1, T-brain-1) (APC) discontinued
T1848-23-APC 100 µL

T-box Brain Protein 1 (TBR1, T-box Brain 1, T-brain-1) (APC) discontinued

Sign In for Pricing
View Details
1-Naphthyl isocyanate 98 % pure
LC-10846.1 25 g

1-Naphthyl isocyanate 98 % pure

Sign In for Pricing
View Details
Human Protein phosphatase 2 ELISA Kit
MBS7273546-01 48 Well

Human Protein phosphatase 2 ELISA Kit

Sign In for Pricing
View Details