Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Animal-Free BMP-10, Human (His)

BMP-10 is essential for embryonic cardiomyocyte proliferation, preventing premature activation of CDKN1C/p57KIP and ensuring optimal expression of MEF2C and NKX2-5.As a ligand for AVRL1/ALK1, BMPR1A/ALK3 and BMPR1B/ALK6, it activates SMAD1, SMAD5 and SMAD8, regulating key signaling pathways.Animal-Free BMP-10 Protein, Human (His) is the recombinant human-derived animal-FreeBMP-10 protein, expressed by E.coli , with C-His labeled tag.This product is for cell culture use only.

Product Specifications

Product Name Alternative

Animal-Free BMP-10 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/animal-free-bmp-10-protein-human-his.html

Purity

98.0

Smiles

MNAKGNYCKRTPLYIDFKEIGWDSWIIAPPGYEAYECRGVCNYPLAEHLTPTKHAIIQALVHLKNSQKASKACCVPTKLEPISILYLDKGVVTYKFKYEGMAVSECGCR

Molecular Formula

27302 (Gene_ID) O95393 (N317-R424) (Accession)

Molecular Weight

Approximately 16 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Hsa-miR-522-3p miRNA Mimic
CMH0298-01 5 nmol

Hsa-miR-522-3p miRNA Mimic

Sign In for Pricing
View Details
Hsa-miR-522-3p miRNA Mimic
CMH0298-02 10 nmol

Hsa-miR-522-3p miRNA Mimic

Sign In for Pricing
View Details
Mouse hepatocyte growth factor,HGF ELISA KIT
JOT-EK0675Mo 96 wells

Mouse hepatocyte growth factor,HGF ELISA KIT

Sign In for Pricing
View Details
Gm10733 3'UTR Luciferase Stable Cell Line
TU107346 1.0 mL

Gm10733 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
KEL Mouse Monoclonal Antibody [Clone ID: LBI8E1]
AMM20318V 100 µL

KEL Mouse Monoclonal Antibody [Clone ID: LBI8E1]

Sign In for Pricing
View Details
Mouse Monoclonal KIR3DL1 Antibody (MM0443-1L34) [DyLight 650]
NBP2-11763C 0.1 mL

Mouse Monoclonal KIR3DL1 Antibody (MM0443-1L34) [DyLight 650]

Sign In for Pricing
View Details