Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CSF3, Rhesus macaque

CSF3 Protein, a member of the IL-6 superfamily, is a vital granulocyte/macrophage colony-stimulating factor influencing hematopoiesis. It regulates the production, differentiation, and function of granulocytes and monocytes-macrophages, playing a key role in the intricate balance of hematopoietic processes. CSF3's significance within the IL-6 superfamily extends to orchestrating immune system components for optimal functionality. CSF3 Protein, Rhesus macaque is the recombinant Rhesus Macaque-derived CSF3 protein, expressed by E. coli , with tag free.

Product Specifications

Product Name Alternative

CSF3 Protein, Rhesus macaque, Rhesus Macaque, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/csf3-protein-rhesus-macaque.html

Purity

95.0

Smiles

TPLGPASSLPQSFLLKCLEQVRKIQGDGAALQEKLCATYKLCHPEELVLLRHSLGIPWAPLSSCPSQALQLTGCLSQLHSSLFLYQGLLQALEGISPELSPTLDTLQLDIADFATTIWQQMEDLGMAPALQPTQGAMPAFTSAFQRRAGGVLVASHLQRFLELAYRVLRHLAQS

Molecular Formula

/ (Gene_ID) F7H1Q6 (T31-S207) (Accession)

Molecular Weight

Approximately 18-20 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

ALDOA Antibody
A73883-100UL 100 µL

ALDOA Antibody

Ask
View Details
PRPF31 Recombinant Antibody, Biotin Conjugated
bsm-62711R-Biotin-01 20 µL

PRPF31 Recombinant Antibody, Biotin Conjugated

Ask
View Details
PRPF31 Recombinant Antibody, Biotin Conjugated
bsm-62711R-Biotin-02 100 µL

PRPF31 Recombinant Antibody, Biotin Conjugated

Ask
View Details
PLSCR3 (Phospholipid Scramblase 3, PL Scramblase 3, Ca (2+) -dependent Phospholipid Scramblase 3) (MaxLight 405) discontinued
131499-ML405 100 µL

PLSCR3 (Phospholipid Scramblase 3, PL Scramblase 3, Ca (2+) -dependent Phospholipid Scramblase 3) (MaxLight 405) discontinued

Ask
View Details
Lentiviral human ZCCHC8 sgRNA gene knockout kit - Lentiviral human ZCCHC8 sgRNA gene knockout kit (25)
GTR15366981 1 Vial

Lentiviral human ZCCHC8 sgRNA gene knockout kit - Lentiviral human ZCCHC8 sgRNA gene knockout kit (25)

Ask
View Details