Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CSF3, Rhesus macaque

CSF3 Protein, a member of the IL-6 superfamily, is a vital granulocyte/macrophage colony-stimulating factor influencing hematopoiesis. It regulates the production, differentiation, and function of granulocytes and monocytes-macrophages, playing a key role in the intricate balance of hematopoietic processes. CSF3's significance within the IL-6 superfamily extends to orchestrating immune system components for optimal functionality. CSF3 Protein, Rhesus macaque is the recombinant Rhesus Macaque-derived CSF3 protein, expressed by E. coli , with tag free.

Product Specifications

Product Name Alternative

CSF3 Protein, Rhesus macaque, Rhesus Macaque, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/csf3-protein-rhesus-macaque.html

Purity

95.0

Smiles

TPLGPASSLPQSFLLKCLEQVRKIQGDGAALQEKLCATYKLCHPEELVLLRHSLGIPWAPLSSCPSQALQLTGCLSQLHSSLFLYQGLLQALEGISPELSPTLDTLQLDIADFATTIWQQMEDLGMAPALQPTQGAMPAFTSAFQRRAGGVLVASHLQRFLELAYRVLRHLAQS

Molecular Formula

/ (Gene_ID) F7H1Q6 (T31-S207) (Accession)

Molecular Weight

Approximately 18-20 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

APC/CY7-Linked Polyclonal Antibody to Glial Cell Line Derived Neurotrophic Factor Receptor Alpha 2 (GFRa2)
MBS2063709-01 0.1 mL

APC/CY7-Linked Polyclonal Antibody to Glial Cell Line Derived Neurotrophic Factor Receptor Alpha 2 (GFRa2)

Ask
View Details
APC/CY7-Linked Polyclonal Antibody to Glial Cell Line Derived Neurotrophic Factor Receptor Alpha 2 (GFRa2)
MBS2063709-02 0.2 mL

APC/CY7-Linked Polyclonal Antibody to Glial Cell Line Derived Neurotrophic Factor Receptor Alpha 2 (GFRa2)

Ask
View Details
APC/CY7-Linked Polyclonal Antibody to Glial Cell Line Derived Neurotrophic Factor Receptor Alpha 2 (GFRa2)
MBS2063709-03 0.5 mL

APC/CY7-Linked Polyclonal Antibody to Glial Cell Line Derived Neurotrophic Factor Receptor Alpha 2 (GFRa2)

Ask
View Details
APC/CY7-Linked Polyclonal Antibody to Glial Cell Line Derived Neurotrophic Factor Receptor Alpha 2 (GFRa2)
MBS2063709-04 1 mL

APC/CY7-Linked Polyclonal Antibody to Glial Cell Line Derived Neurotrophic Factor Receptor Alpha 2 (GFRa2)

Ask
View Details
APC/CY7-Linked Polyclonal Antibody to Glial Cell Line Derived Neurotrophic Factor Receptor Alpha 2 (GFRa2)
MBS2063709-05 5 mL

APC/CY7-Linked Polyclonal Antibody to Glial Cell Line Derived Neurotrophic Factor Receptor Alpha 2 (GFRa2)

Ask
View Details
APC/CY7-Linked Polyclonal Antibody to Glial Cell Line Derived Neurotrophic Factor Receptor Alpha 2 (GFRa2)
MBS2063709-06 5x 5 mL

APC/CY7-Linked Polyclonal Antibody to Glial Cell Line Derived Neurotrophic Factor Receptor Alpha 2 (GFRa2)

Ask
View Details