Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Macaca mulatta Interleukin-10 (IL10)

Product Specifications

Product Name Alternative

Cytokine synthesis inhibitory factor (CSIF)

Abbreviation

Recombinant Rhesus macaque IL10 protein

Gene Name

IL10

UniProt

P51496

Expression Region

19-178aa

Organism

Macaca mulatta (Rhesus macaque)

Target Sequence

SPGQGTQSENSCTRFPGNLPHMLRDLRDAFSRVKTFFQMKDQLDNILLKESLLEDFKGYLGCQALSEMIQFYLEEVMPQAENHDPDIKEHVNSLGENLKTLRLRLRRCHRFLPCENKSKAVEQVKNAFSKLQEKGVYKAMSEFDIFINYIEAYMTMKIQN

Tag

C-terminal hFc1-tagged

Type

In Stock Protein

Source

Mammalian cell

Field of Research

Immunology

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

46.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Frozen Tissue Sections, Ovary
CS629874 5x 5 µm

Frozen Tissue Sections, Ovary

Sign In for Pricing
View Details
PARL Mouse Monoclonal Antibody [Clone ID: 8C4B2]
AM06254SU-N 100 µL

PARL Mouse Monoclonal Antibody [Clone ID: 8C4B2]

Sign In for Pricing
View Details
Human HB (Hemoglobin) ELISA Kit
E-EL-H0415-01 24 Tests

Human HB (Hemoglobin) ELISA Kit

Sign In for Pricing
View Details
Human HB (Hemoglobin) ELISA Kit
E-EL-H0415-02 48 Tests

Human HB (Hemoglobin) ELISA Kit

Sign In for Pricing
View Details
Human HB (Hemoglobin) ELISA Kit
E-EL-H0415-03 96 Tests

Human HB (Hemoglobin) ELISA Kit

Sign In for Pricing
View Details
MRPL35 Rabbit Polyclonal Antibody
TA384801 100 µL

MRPL35 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details