Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TREML1, Human (HEK293, hFc)

TREML1 is a trigger receptor 1 expressed on myeloid cells that activates myeloid cells via the adaptor protein DAP12. TREML1 promotes microglial phagocytosis of Aβ and is associated with the immune response to AD. TREML1 Protein, Human (HEK293, hFc) is the recombinant human-derived TREML1 protein, expressed by HEK293 , with C-hFc labeled tag.

Product Specifications

Product Name Alternative

TREML1 Protein, Human (HEK293, hFc), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/treml1-protein-human-147a-a-hek293-hfc-solutin.html

Purity

95.0

Smiles

QGIVGSLPEVLQAPVGSSILVQCHYRLQDVKAQKVWCRFLPEGCQPLVSSAVDRRAPAGRRTFLTDLGGGLLQVEMVTLQEEDAGEYGCMVDGARGPQILHRVSLNILPPEEEEETHKIGSLAENAFSDPAGSANPLEPSQDEKSIP

Molecular Formula

340205 (Gene_ID) Q86YW5/XP_016866312.1 (Q16-P162) (Accession)

Molecular Weight

Approximately 50-60 kDa due to glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

(R)-Phenylephrine-d3 Hydrochloride
TRC-P320642-1MG 1 mg

(R)-Phenylephrine-d3 Hydrochloride

Sign In for Pricing
View Details
Thioredoxin 2, Mitochondrial (TXN2) Antibody
abx137695-01 5 µg

Thioredoxin 2, Mitochondrial (TXN2) Antibody

Sign In for Pricing
View Details
Thioredoxin 2, Mitochondrial (TXN2) Antibody
abx137695-02 20 µg

Thioredoxin 2, Mitochondrial (TXN2) Antibody

Sign In for Pricing
View Details
Thioredoxin 2, Mitochondrial (TXN2) Antibody
abx137695-03 100 µg

Thioredoxin 2, Mitochondrial (TXN2) Antibody

Sign In for Pricing
View Details
Anti-CD147/Emmprin/BSG Antibody Picoband® Fluoro488 Conjugated
A00248-1-Fluoro488 100 µg/Vial

Anti-CD147/Emmprin/BSG Antibody Picoband® Fluoro488 Conjugated

Sign In for Pricing
View Details
Human Monoclonal IL-5 Antibody (mepolizumab) [mFluor Violet 450 SE]
NBP3-28010MFV450 0.1 mL

Human Monoclonal IL-5 Antibody (mepolizumab) [mFluor Violet 450 SE]

Sign In for Pricing
View Details