Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Regenerating islet-derived protein 3-beta (Reg3b)

Product Specifications

Product Name Alternative

REG-3-beta; Pancreatitis-associated protein 1; Regenerating islet-derived protein III-beta; Reg III-beta

Abbreviation

Recombinant Mouse Reg3b protein

Gene Name

Reg3b

UniProt

P35230

Expression Region

38-175aa

Organism

Mus musculus (Mouse)

Target Sequence

ISCPKGSQAYGSYCYALFQIPQTWFDAELACQKRPGGHLVSVLNSAEASFLSSMVKRTGNSYQYTWIGLHDPTLGAEPNGGGWEWSNNDVMNYFNWERNPSTALDRAFCGSLSRASGFLKWRDMTCEVKLPYVCKFTG

Tag

Tag-Free

Type

In Stock Protein

Source

E.coli

Field of Research

Others

Relevance

Bactericidal C-type lectin which acts against several intestinal Gram-positive and Gram-negative bacteria. Lacks antibacterial activity against S.typhimurium. May play a role in protection against infection with S.enteritidis by inhibiting its translocation from the gut lumen into intestinal tissues and further extraintestinal tissues.

Endotoxin

Not test

Purity

Greater than 95% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

15.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Il2rg 3'UTR GFP Stable Cell Line
TU256248 1.0 mL

Il2rg 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Mouse Nfya Pre-designed siRNA Set A
SI109321A 1 Each

Mouse Nfya Pre-designed siRNA Set A

Sign In for Pricing
View Details
B3GALNT2 siRNA (Mouse)
CRN0369-01 15 nmol

B3GALNT2 siRNA (Mouse)

Sign In for Pricing
View Details
B3GALNT2 siRNA (Mouse)
CRN0369-02 30 nmol

B3GALNT2 siRNA (Mouse)

Sign In for Pricing
View Details
Pentraxin-Related protein PTX3 (PTX3) Bovine ELISA Kit
F7504 96 Tests

Pentraxin-Related protein PTX3 (PTX3) Bovine ELISA Kit

Sign In for Pricing
View Details
Mouse Tap1 qPCR Primer Pair
QM05354S 200 Tests

Mouse Tap1 qPCR Primer Pair

Sign In for Pricing
View Details