Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SMAD3, Human/Mouse/Rat (Flag-His)

The SMAD3 protein acts as a receptor-regulated SMAD (R-SMAD), transducing signals from TGF-β and activin type 1 receptor kinase. After being activated by antigen-presenting cells, SMAD3 binds to the TRE element in the gene promoter and forms a complex with SMAD4 to activate transcription. SMAD3 Protein, Human/Mouse/Rat (Flag-His) is the recombinant human-derived SMAD3 protein, expressed by E. coli , with N-6*His, N-Flag labeled tag.

Product Specifications

Product Name Alternative

SMAD3 Protein, Human/Mouse/Rat (Flag-His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/smad3-protein-human-flag-his.html

Purity

93.92

Smiles

SSILPFTPPIVKRLLGWKKGEQNGQEEKWCEKAVKSLVKKLKKTGQLDELEKAITTQNVNTKCITIPRSLDGRLQVSHRKGLPHVIYCRLWRWPDLHSHHELRAMELCEFAFNMKKDEVCVNPYHYQRVETPVLPPVLVPRHTEIPAEFPPLDDYSHSIPENTNFPAGIEPQSNIPETPPPGYLSEDGETSDHQMNHSMDAGSPNLSPNPMSPAHNNLDLQPVTYCEPAFWCSISYYELNQRVGETFHASQPSMTVDGFTDPSNSERFCLGLLSNVNRNAAVELTRRHIGRGVRLYYIGGEVFAECLSDSAIFVQSPNCNQRYGWHPATVCKIPPGCNLKIFNNQEFAALLAQSVNQGFEAVYQLTRMCTIRMSFVKGWGAEYRRQTVTSTPCWIELHLNGPLQWLDKVLTQMGSPSIRCSSVS

Molecular Formula

4088/17127/25631 (Gene_ID) P84022-1/Q8BUN5/P84025 (S2-S425) (Accession)

Molecular Weight

Approximately 50-60 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Dry ice.

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cdon (NM_021339) Mouse Tagged ORF Clone
MG223047 10 µg

Cdon (NM_021339) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
PATL2, ID (PATL2, Protein PAT1 homolog 2, PAT1-like protein 2, Protein PAT1 homolog a) (MaxLight 490) discontinued
039695-ML490 100 µL

PATL2, ID (PATL2, Protein PAT1 homolog 2, PAT1-like protein 2, Protein PAT1 homolog a) (MaxLight 490) discontinued

Sign In for Pricing
View Details
LONF1 Rabbit Polyclonal Antibody
BT-AP11092-01 20 µL

LONF1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
LONF1 Rabbit Polyclonal Antibody
BT-AP11092-02 50 µL

LONF1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
LONF1 Rabbit Polyclonal Antibody
BT-AP11092-03 100 µL

LONF1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Anti-GINS2 Antibody
MBS8292704-01 0.03 mL

Anti-GINS2 Antibody

Sign In for Pricing
View Details