Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Animal-Free EGF, Human (His)

EGF protein does not possess the conserved residue (s) necessary for propagating feature annotation. Animal-Free EGF Protein, Human (His) is the recombinant human-derived animal-FreeEGF protein, expressed by E. coli , with C-His labeled tag. This product is for cell culture use only.

Product Specifications

Product Name Alternative

Animal-Free EGF Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/animal-free-egf-protein-human-his.html

Purity

95.00

Smiles

MNSDSECPLSHDGYCLHDGVCMYIEALDKYACNCVVGYIGERCQYRDLKWWELR

Molecular Formula

1950 (Gene_ID) P01133-1 (N971-R1023) (Accession)

Molecular Weight

Approximately 9-11 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal Actin11 Antibody (mAb2345a) [Allophycocyanin]
NBP2-53120APC 0.1 mL

Mouse Monoclonal Actin11 Antibody (mAb2345a) [Allophycocyanin]

Sign In for Pricing
View Details
N- (8-Benzyl-8-azabicyclo[3.2.1]oct-3-yl-exo) -2-methylpropanamide
262387-01 10 mg

N- (8-Benzyl-8-azabicyclo[3.2.1]oct-3-yl-exo) -2-methylpropanamide

Sign In for Pricing
View Details
N- (8-Benzyl-8-azabicyclo[3.2.1]oct-3-yl-exo) -2-methylpropanamide
262387-02 25 mg

N- (8-Benzyl-8-azabicyclo[3.2.1]oct-3-yl-exo) -2-methylpropanamide

Sign In for Pricing
View Details
N- (8-Benzyl-8-azabicyclo[3.2.1]oct-3-yl-exo) -2-methylpropanamide
262387-03 50 mg

N- (8-Benzyl-8-azabicyclo[3.2.1]oct-3-yl-exo) -2-methylpropanamide

Sign In for Pricing
View Details
N- (8-Benzyl-8-azabicyclo[3.2.1]oct-3-yl-exo) -2-methylpropanamide
262387-04 100 mg

N- (8-Benzyl-8-azabicyclo[3.2.1]oct-3-yl-exo) -2-methylpropanamide

Sign In for Pricing
View Details
N- (8-Benzyl-8-azabicyclo[3.2.1]oct-3-yl-exo) -2-methylpropanamide
262387-05 250 mg

N- (8-Benzyl-8-azabicyclo[3.2.1]oct-3-yl-exo) -2-methylpropanamide

Sign In for Pricing
View Details